(data stored in ACNUC7421 zone)

EMBL: AP009493.PE76

AP009493.PE76        Location/Qualifiers
FT   CDS             78928..79122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_76t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_76t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16905"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM04"
FT                   /protein_id="BAG16905.1"
FT                   /translation="MSWSASAGLRRGRSAPPAQGGVLVQDAVLALVGVQGPELFDGSLI
FT                   PRATGHFGHDLRSEVRGTV"
     MSWSASAGLR RGRSAPPAQG GVLVQDAVLA LVGVQGPELF DGSLIPRATG HFGHDLRSEV        60
     RGTV                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page