(data stored in ACNUC7421 zone)

EMBL: AP009493.PE77

AP009493.PE77        Location/Qualifiers
FT   CDS             complement(79135..80763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_77t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_77t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16906"
FT                   /db_xref="GOA:B1VM05"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM05"
FT                   /protein_id="BAG16906.1"
FT                   /translation="MTPNRRPRSAPNDRELRLWKVGRALTLAFAAAVLVAGGVFYFLVV
FT                   LLDVQEIGATAKLDAKTLFDLVKLSFGVVAGAGALVALVVAYRRQRVDEAGAHREATRL
FT                   HTERFSQAVDKLGSDSPAVRLGGVHALAGLADDAPDNSLRQTCIDVLCAYLQLPFTPDP
FT                   GTDPAHQEEHHRYLAFRKVRHTILRLIGDHYRRPKGTHRSWQGCDLDLTGVTIDGDMDF
FT                   RGATFCGGTVSFSGATFSGSIVSFDDARFSGGTVSFSGATFSGGIVSFDDARFSGGTVS
FT                   FSGATFSGGIVSFDDARFSGGTVSFRHATFSGGDVSFDEAVFSGDVSFGGAMFSGGTVS
FT                   FGDATFSDGTVYFRSATFSGGTVSFRHATFSGGDVSFDEAVFSGDVSFGGAMFSGGTVS
FT                   FGDATFSDGTVSFRSATFSGGTVSFRHAMLSGGEVYFRSATFSGGTVYIDDAMFSGGEV
FT                   SFRSATFSSGTVYFRNATFSGGTVSFRGATFSGGTVSFRSATFSSGDLSFDGAIGSAPQ
FT                   GLLAAVGTPPPSGVTLPSAWLPSAP"
     MTPNRRPRSA PNDRELRLWK VGRALTLAFA AAVLVAGGVF YFLVVLLDVQ EIGATAKLDA        60
     KTLFDLVKLS FGVVAGAGAL VALVVAYRRQ RVDEAGAHRE ATRLHTERFS QAVDKLGSDS       120
     PAVRLGGVHA LAGLADDAPD NSLRQTCIDV LCAYLQLPFT PDPGTDPAHQ EEHHRYLAFR       180
     KVRHTILRLI GDHYRRPKGT HRSWQGCDLD LTGVTIDGDM DFRGATFCGG TVSFSGATFS       240
     GSIVSFDDAR FSGGTVSFSG ATFSGGIVSF DDARFSGGTV SFSGATFSGG IVSFDDARFS       300
     GGTVSFRHAT FSGGDVSFDE AVFSGDVSFG GAMFSGGTVS FGDATFSDGT VYFRSATFSG       360
     GTVSFRHATF SGGDVSFDEA VFSGDVSFGG AMFSGGTVSF GDATFSDGTV SFRSATFSGG       420
     TVSFRHAMLS GGEVYFRSAT FSGGTVYIDD AMFSGGEVSF RSATFSSGTV YFRNATFSGG       480
     TVSFRGATFS GGTVSFRSAT FSSGDLSFDG AIGSAPQGLL AAVGTPPPSG VTLPSAWLPS       540
     AP                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page