(data stored in ACNUC7421 zone)

EMBL: AP009493.PE78

AP009493.PE78        Location/Qualifiers
FT   CDS             complement(80760..81101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_78t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_78t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16907"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM06"
FT                   /protein_id="BAG16907.1"
FT                   /translation="MRYKAPGDRFPFSDRSFPALWQIFGGQGEAAAHEVDLDDPYGDLV
FT                   ALAHDLAGVVDGLVTVGSTSPSCPAVSASWARSSPGLIDAPPVYSSGFPPRHTGLAATA
FT                   DPPAVSSAS"
     MRYKAPGDRF PFSDRSFPAL WQIFGGQGEA AAHEVDLDDP YGDLVALAHD LAGVVDGLVT        60
     VGSTSPSCPA VSASWARSSP GLIDAPPVYS SGFPPRHTGL AATADPPAVS SAS              113
//

If you have problems or comments...

PBIL Back to PBIL home page