(data stored in ACNUC7421 zone)

EMBL: AP009493.PE8

AP009493.PE8         Location/Qualifiers
FT   CDS             complement(7722..14138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_8t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_8t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16837"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK6"
FT                   /protein_id="BAG16837.1"
FT                   /translation="MSSTPFRRRVPGPGLRRWLGRGALVVTLSVFPQVAIPAEFSSLAQ
FT                   AQPSAQNKELEDRPDAKIDKVGRLKPGKSKAPNNKAAPAARETRERLKKAAWPKADKAT
FT                   AEVEASGGTETNVGGLGVKLAQQPVAPAGKQAKSTTKAKATGPAEKVALNVHSQAVAKK
FT                   AGINGVLLTVDPAGAASSKSADDTDTLRVSLDYSTFNDVYGGNFGPRLNLVALPACALT
FT                   TPKKKSCRTQTPVSGADNDAKSQTLTGTIPARSLKAGTPMVLAAAASSSGSGSDYSATP
FT                   LSPTATWEAGGSTGDFTWNYPLRVPPATAGPSPNLSILYNSASVDGRTAGENNQTSVIG
FT                   EGFALTESYIERKYGSCKDDGHSSKGDLCWKYANATLVLNGKAAELVNTCADKAACDAA
FT                   ALSEAAGGSWKLKNEDGTKVEHLTGATGNNDNNTEYWKVTDASGIQYFFGKHRLPGWSN
FT                   KGTTDTADDDPVTNSTWNVPVYGDDPGEPCYKSTGFADSSCMQTWRWNLDYVVDPHGNA
FT                   STYWYTKEANYYSKNADTTVNGTAYTRGGYLNRIDYGLRSELLYSKPAAQQVRFTYAER
FT                   CVTSGACTSLTEDTKADWPDVPYDMVCASGTKCTTQIGPAFFTRKRLTHITTSVWTGTG
FT                   TTRRDVDTWHLDQSFPNTGDASSPSLWLKSIQNTGKANDKAAAMPPVVFGGIQMPNHVE
FT                   GSGPDTLRYIKWRVRTIKSETGSTLTANYSNPDCIWGSSMPAAVDKNTRRCFPVKWSQS
FT                   GATPTTDWFHKYVVTSVFQEDPYGHGDTMETYYDYQGGAGWAYSDDEGLTKASNRTWSQ
FT                   WRGYGKVVTTSGDSEGPRSKNSALYMRGLNGEKELDGTARVEKVTDSTGTAIDDSRQYA
FT                   GFVRETIAYNNTAEVSGTISTPWSHKTGSHTYNWGTTDSWIVQAGESTSRTKTSTGTRT
FT                   TKQKTTYDTTYGMPLTMDDSGDTAKSGDETCRRTSYARNTSAWLVNRVSRVETYAVPCT
FT                   TAPTIPDDVVSDVATAYDNQEVGTAPSKGEITSSYRVANYGATDKKPIYQKVSGASYDK
FT                   LGRPLTKTNAQDQTLKTTYLPDDTGYGPLRSKTLTDPKLFTATTEVDPAWGTATKITNA
FT                   NGNVTEWSFDALGRLLSVWKPDRSRVGNDAASITYAYSINNEKETWVRTDTLKADGKTY
FT                   NSSYEIFDGLLRSRQVQTPAPNGGRVISETLYDDRGLAYMANSQIHDNNAPSGTLANTY
FT                   PGSTPASTETVYDEAGRATDSIFRVYNQEKWRTKTDKQGDRTAVTAAAGGSGTLTMVDA
FT                   RGRVTERREYAGPTPTGSDYTRTLYEYTAAGQLKKLSGPDGAVWTRSYDLRGREITSTD
FT                   PDKGSITSTYNDADQPVSATTTLNGVSRTVLTDYDELGRRIGTWDGTKDDAHRLTKFTY
FT                   DSLAKGQPTASIRYVGGTTGKIYSKSVTGYDVLGRAKGTKTVIAATDPLVTAGAPQSFT
FT                   TSTVYNMDGTVQSTSLPAAAGLPAETIENSYNGLGMLTGTDGMTDYVQSIGYSPYGEIE
FT                   ETRLGTSTGAKQMQILNRYEDGTRRLANSHTVDQTNTGYTSDVDYLYDATGNVKSMTDK
FT                   ANGKDTQCFAYDGYRRLTEAWTPSSNDCATARSSSALGGPAPYWTSWTYKVGGLRDTQT
FT                   EHKAAGDTKTSYGYPAVKADGTGQPHTLTSISVGAGTAKPFTYDERGNTTKRYGPTGSA
FT                   QTLVWDIEGKLTRLTEGTNTTDYLYDANGELLIRRGSGETVLYLAGQELHYDVNSKKFT
FT                   AKRYYTAGGATAVRTDAGLSWVVDDHHGTASMTVDATTQSVTRRYTKPFGENRGNAPTT
FT                   WPDDKGFLGKPADADTGLTHIGAREYDPITGRFLSVDPILVPEDHESLNGYAYSNNTPV
FT                   TLSDPTGLRPDGACGGSSSSCNGGTETWTKTSTGWDYNYQKEVTLPGTKTIMTSTVTYS
FT                   SGVTSTKVEFKPGPTPLPVLRAGAGPGFQLFSGGPAGVRLPGPLGFLGGLTRELDGSAI
FT                   REMAEELAEGRTDEDDDEFYYLYRAPHIGNKEAERHGPRPENHPPTKTKFRTEPGLAFL
FT                   GDTASVAEQYAGETQFEHGYWRYKMKPGFKKAFPAAKYRTPHENSRGAIEFEWIIPQAE
FT                   IPRFNSFIEGGSSKWTNYYSSGGYVYRD"
     MSSTPFRRRV PGPGLRRWLG RGALVVTLSV FPQVAIPAEF SSLAQAQPSA QNKELEDRPD        60
     AKIDKVGRLK PGKSKAPNNK AAPAARETRE RLKKAAWPKA DKATAEVEAS GGTETNVGGL       120
     GVKLAQQPVA PAGKQAKSTT KAKATGPAEK VALNVHSQAV AKKAGINGVL LTVDPAGAAS       180
     SKSADDTDTL RVSLDYSTFN DVYGGNFGPR LNLVALPACA LTTPKKKSCR TQTPVSGADN       240
     DAKSQTLTGT IPARSLKAGT PMVLAAAASS SGSGSDYSAT PLSPTATWEA GGSTGDFTWN       300
     YPLRVPPATA GPSPNLSILY NSASVDGRTA GENNQTSVIG EGFALTESYI ERKYGSCKDD       360
     GHSSKGDLCW KYANATLVLN GKAAELVNTC ADKAACDAAA LSEAAGGSWK LKNEDGTKVE       420
     HLTGATGNND NNTEYWKVTD ASGIQYFFGK HRLPGWSNKG TTDTADDDPV TNSTWNVPVY       480
     GDDPGEPCYK STGFADSSCM QTWRWNLDYV VDPHGNASTY WYTKEANYYS KNADTTVNGT       540
     AYTRGGYLNR IDYGLRSELL YSKPAAQQVR FTYAERCVTS GACTSLTEDT KADWPDVPYD       600
     MVCASGTKCT TQIGPAFFTR KRLTHITTSV WTGTGTTRRD VDTWHLDQSF PNTGDASSPS       660
     LWLKSIQNTG KANDKAAAMP PVVFGGIQMP NHVEGSGPDT LRYIKWRVRT IKSETGSTLT       720
     ANYSNPDCIW GSSMPAAVDK NTRRCFPVKW SQSGATPTTD WFHKYVVTSV FQEDPYGHGD       780
     TMETYYDYQG GAGWAYSDDE GLTKASNRTW SQWRGYGKVV TTSGDSEGPR SKNSALYMRG       840
     LNGEKELDGT ARVEKVTDST GTAIDDSRQY AGFVRETIAY NNTAEVSGTI STPWSHKTGS       900
     HTYNWGTTDS WIVQAGESTS RTKTSTGTRT TKQKTTYDTT YGMPLTMDDS GDTAKSGDET       960
     CRRTSYARNT SAWLVNRVSR VETYAVPCTT APTIPDDVVS DVATAYDNQE VGTAPSKGEI      1020
     TSSYRVANYG ATDKKPIYQK VSGASYDKLG RPLTKTNAQD QTLKTTYLPD DTGYGPLRSK      1080
     TLTDPKLFTA TTEVDPAWGT ATKITNANGN VTEWSFDALG RLLSVWKPDR SRVGNDAASI      1140
     TYAYSINNEK ETWVRTDTLK ADGKTYNSSY EIFDGLLRSR QVQTPAPNGG RVISETLYDD      1200
     RGLAYMANSQ IHDNNAPSGT LANTYPGSTP ASTETVYDEA GRATDSIFRV YNQEKWRTKT      1260
     DKQGDRTAVT AAAGGSGTLT MVDARGRVTE RREYAGPTPT GSDYTRTLYE YTAAGQLKKL      1320
     SGPDGAVWTR SYDLRGREIT STDPDKGSIT STYNDADQPV SATTTLNGVS RTVLTDYDEL      1380
     GRRIGTWDGT KDDAHRLTKF TYDSLAKGQP TASIRYVGGT TGKIYSKSVT GYDVLGRAKG      1440
     TKTVIAATDP LVTAGAPQSF TTSTVYNMDG TVQSTSLPAA AGLPAETIEN SYNGLGMLTG      1500
     TDGMTDYVQS IGYSPYGEIE ETRLGTSTGA KQMQILNRYE DGTRRLANSH TVDQTNTGYT      1560
     SDVDYLYDAT GNVKSMTDKA NGKDTQCFAY DGYRRLTEAW TPSSNDCATA RSSSALGGPA      1620
     PYWTSWTYKV GGLRDTQTEH KAAGDTKTSY GYPAVKADGT GQPHTLTSIS VGAGTAKPFT      1680
     YDERGNTTKR YGPTGSAQTL VWDIEGKLTR LTEGTNTTDY LYDANGELLI RRGSGETVLY      1740
     LAGQELHYDV NSKKFTAKRY YTAGGATAVR TDAGLSWVVD DHHGTASMTV DATTQSVTRR      1800
     YTKPFGENRG NAPTTWPDDK GFLGKPADAD TGLTHIGARE YDPITGRFLS VDPILVPEDH      1860
     ESLNGYAYSN NTPVTLSDPT GLRPDGACGG SSSSCNGGTE TWTKTSTGWD YNYQKEVTLP      1920
     GTKTIMTSTV TYSSGVTSTK VEFKPGPTPL PVLRAGAGPG FQLFSGGPAG VRLPGPLGFL      1980
     GGLTRELDGS AIREMAEELA EGRTDEDDDE FYYLYRAPHI GNKEAERHGP RPENHPPTKT      2040
     KFRTEPGLAF LGDTASVAEQ YAGETQFEHG YWRYKMKPGF KKAFPAAKYR TPHENSRGAI      2100
     EFEWIIPQAE IPRFNSFIEG GSSKWTNYYS SGGYVYRD                              2138
//

If you have problems or comments...

PBIL Back to PBIL home page