(data stored in ACNUC7421 zone)

EMBL: AP009493.PE81

AP009493.PE81        Location/Qualifiers
FT   CDS             84532..84825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_81t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_81t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16910"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM09"
FT                   /protein_id="BAG16910.1"
FT                   /translation="MDTVVRDFQNTYAQAPAQEDLARLLTLVLNSRDLPDADREEAAGA
FT                   VHDLARITAGPEPDTATARTRLQRLRELLTAGADITQPALAIVTSVAGMLGA"
     MDTVVRDFQN TYAQAPAQED LARLLTLVLN SRDLPDADRE EAAGAVHDLA RITAGPEPDT        60
     ATARTRLQRL RELLTAGADI TQPALAIVTS VAGMLGA                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page