(data stored in ACNUC7421 zone)

EMBL: AP009493.PE82

AP009493.PE82        Location/Qualifiers
FT   CDS             complement(84916..85536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_82t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_82t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16911"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM10"
FT                   /protein_id="BAG16911.1"
FT                   /translation="MGMDLTVFMVDWGQLGTVPVEHRIGRLEDLAWPGELSDVYDGGAE
FT                   RAHGWLWPPGQAPAWCAVYRFLTTTGAHMPHVRAGAAWADMRPLVGPPVREVMDSFLEG
FT                   LIWDGDQADAPAPVGVGAFPAAADRWHPNVLLVCLPEAVAGKARAWERMELYLEKLSGP
FT                   FAVECEGWAGRPDTFEGFVALLREWGAVVTEAARRGWGLVGLP"
     MGMDLTVFMV DWGQLGTVPV EHRIGRLEDL AWPGELSDVY DGGAERAHGW LWPPGQAPAW        60
     CAVYRFLTTT GAHMPHVRAG AAWADMRPLV GPPVREVMDS FLEGLIWDGD QADAPAPVGV       120
     GAFPAAADRW HPNVLLVCLP EAVAGKARAW ERMELYLEKL SGPFAVECEG WAGRPDTFEG       180
     FVALLREWGA VVTEAARRGW GLVGLP                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page