(data stored in ACNUC7421 zone)

EMBL: AP009493.PE83

AP009493.PE83        Location/Qualifiers
FT   CDS             complement(85734..86078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_83t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_83t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16912"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM11"
FT                   /protein_id="BAG16912.1"
FT                   /translation="MPGGIVSPRSYGRRQVPGRPGPVSERSGHMGEINVSSRDLGRLLT
FT                   DRTGTPARPYQEAFAKLADTYRGKPVPEILPLLRQAADEALLGFTDADLREQAEAIRSG
FT                   ARYVLRVRVT"
     MPGGIVSPRS YGRRQVPGRP GPVSERSGHM GEINVSSRDL GRLLTDRTGT PARPYQEAFA        60
     KLADTYRGKP VPEILPLLRQ AADEALLGFT DADLREQAEA IRSGARYVLR VRVT             114
//

If you have problems or comments...

PBIL Back to PBIL home page