(data stored in ACNUC7421 zone)

EMBL: AP009493.PE84

AP009493.PE84        Location/Qualifiers
FT   CDS             complement(86151..86822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_84t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_84t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16913"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM12"
FT                   /protein_id="BAG16913.1"
FT                   /translation="MIKNLVRGFSALSLALVPFLSAPAAQAAPAAEVTTLADAVGLVQV
FT                   TEEDRTGYTRSSFKHWNSGDNASDGCNTRAEVLISEAVVAPAVGAGCKLTGGTWISYYD
FT                   GQEVTSAGSLDIDHMVPLAEAWDSGASAWTAARREAYANDQGAHVSLVAVTARSNRQKS
FT                   DQDPADWMPPSPDAECRYVAEWVSTKLRWQLTADDRELEALKVYADGPCEDTIVRYTPA
FT                   A"
     MIKNLVRGFS ALSLALVPFL SAPAAQAAPA AEVTTLADAV GLVQVTEEDR TGYTRSSFKH        60
     WNSGDNASDG CNTRAEVLIS EAVVAPAVGA GCKLTGGTWI SYYDGQEVTS AGSLDIDHMV       120
     PLAEAWDSGA SAWTAARREA YANDQGAHVS LVAVTARSNR QKSDQDPADW MPPSPDAECR       180
     YVAEWVSTKL RWQLTADDRE LEALKVYADG PCEDTIVRYT PAA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page