(data stored in ACNUC7421 zone)

EMBL: AP009493.PE85

AP009493.PE85        Location/Qualifiers
FT   CDS             complement(87010..87465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_85t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_85t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16914"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM13"
FT                   /protein_id="BAG16914.1"
FT                   /translation="MRFPAEARRDVHVRYTRPSCMGGFAVFTVDFEPLPDRRLGFEFVN
FT                   PLGPDDIDAECAQEVSNGILLWLIGAGPQNVYIDRPPLPTAKELAAGVPVRPDAGPGLI
FT                   ALRAVLLHSRHHPIDSLPWTHARAGWRAADKTWRGTEAAGDPMDLAP"
     MRFPAEARRD VHVRYTRPSC MGGFAVFTVD FEPLPDRRLG FEFVNPLGPD DIDAECAQEV        60
     SNGILLWLIG AGPQNVYIDR PPLPTAKELA AGVPVRPDAG PGLIALRAVL LHSRHHPIDS       120
     LPWTHARAGW RAADKTWRGT EAAGDPMDLA P                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page