(data stored in ACNUC7421 zone)

EMBL: AP009493.PE88

AP009493.PE88        Location/Qualifiers
FT   CDS             88686..88982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_88t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_88t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16917"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM16"
FT                   /protein_id="BAG16917.1"
FT                   /translation="MAVLCSQPTILYPHLQPASRVGRLVEVFTLGASDTKRAGSVLRSV
FT                   ALAVQQPLAAGRDRHHHQVWGLSWQAGGPESSPAVARSREVTGRGLLVSLVFC"
     MAVLCSQPTI LYPHLQPASR VGRLVEVFTL GASDTKRAGS VLRSVALAVQ QPLAAGRDRH        60
     HHQVWGLSWQ AGGPESSPAV ARSREVTGRG LLVSLVFC                                98
//

If you have problems or comments...

PBIL Back to PBIL home page