(data stored in ACNUC7421 zone)

EMBL: AP009493.PE89

AP009493.PE89        Location/Qualifiers
FT   CDS             complement(89693..90163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_89t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_89t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16918"
FT                   /db_xref="GOA:B1VM17"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM17"
FT                   /protein_id="BAG16918.1"
FT                   /translation="MIQQPPHPVRTPLGAGRLSSDIHRLGNVLPPGTTVPIRPDLSREK
FT                   VVNLLLDSPSTLHQFPQTLTRVRRLQQKASQPMSLSRNLMPRRRPGVTGGRPLPFPPPL
FT                   RLTPMPLVTIGTAPPRAAGGRKRRPTETTDTTRSIPCHRILLRADRRHRHPR"
     MIQQPPHPVR TPLGAGRLSS DIHRLGNVLP PGTTVPIRPD LSREKVVNLL LDSPSTLHQF        60
     PQTLTRVRRL QQKASQPMSL SRNLMPRRRP GVTGGRPLPF PPPLRLTPMP LVTIGTAPPR       120
     AAGGRKRRPT ETTDTTRSIP CHRILLRADR RHRHPR                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page