(data stored in ACNUC7421 zone)

EMBL: AP009493.PE9

AP009493.PE9         Location/Qualifiers
FT   CDS             complement(14290..17832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_9t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_9t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16838"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK7"
FT                   /protein_id="BAG16838.1"
FT                   /translation="MASALAAESGERVAVDEATTDSSQVFANPDGTFTQEMNAAPVRAR
FT                   KTDGAWAPIDTTLVREADGSIRAKNTTAALTFSGGGSGTGLVTLKDDGHELKLGWPTEL
FT                   PEPRLDANTATYADVLPAVDLKLTALSSGYTSVLVVKTAQAAANPALATIEMTISGGSL
FT                   DIAATADGGFVARDGDGTPVFESPAGRMWDSAGDNPATASTTSARSAASAESVVVPEAE
FT                   GEPAPSEAPSSGDAEAELPLKVTGTTMEITPDPALLKGKDTVFPLYIDPPTKGIALGDW
FT                   TALSSDGDKFWEFDGDKGVGRCSNHAGYLCSNSPYTQRLYFEYPLSSIHGKKILDATME
FT                   VYQVWTFTCDPHWYDLSTVDKGITSSTTWSVRPKEINLMGDRNVAYGRGGLCDPSQPAN
FT                   WVRFSDNLDETNENLTPTLASAAQNKTSQITFSLTAHDESDAASWARFRNDAKLSVTYV
FT                   SYPSTPTSYGVQQGTTGRACTASTLPFATSDTTPKMLAAVQSADGSQSQLRALFEVWKA
FT                   DGSSRAWYAASPDGAWVADNASRDATSSALPPQTDYRMRVKTQAYYKTDRGATGVLDSS
FT                   WSSWCYFRVDTDSPPPPIVASADGIYKPAATDPAAGGVGTPGKFTFTPGDTNATTPGIQ
FT                   SDVVSYKWKLNSGAVSLSIPVAKGAPTTQSIAPNQAGENTIQVWGFDAAGHSSLTGYYS
FT                   FLVKGAEKPSGVWHLDNALTDSTTATPHALTASGVTWDAKSRSGASALKFNGTTGYAQS
FT                   SGPVVDTTKSFSLSAWARLSDLSRSQTIVSQQATTLSGFALHYSATSQRFAFSRYHSDV
FT                   ASPAASRSTAATAPVANAWTHLTGVYDAAGQTVQLFVNGRPQGQPVPFTTPWLATGSLQ
FT                   IGRFHNSTGYVEHFSGVADEVKVWARALADTEVAHDAWLEDEDLSDGTAGDPVPALVAE
FT                   WDAMDMINATGATIRDTSDFGRNLTLNGAVLTKFTTGDPELGEEVTTTQTMTLNGTSAY
FT                   ATAPGPIVDDSGSFTATAWVTLDPAKFTDTSKSYAVQVFGQSGANQSSWGVWYEQPAGS
FT                   TQGRWTFGRPDKDGTGAAWTRSDSTAFTTAQLGVPVMLTVVYDAQAAANPDDTSKLGGL
FT                   KLHVDSARMGDEDGVAYSAPWQGSGVFEIGRAKINGAAARHFPGKINSVRVWAGSTSTG
FT                   TIANRYNTEQQFQQ"
     MASALAAESG ERVAVDEATT DSSQVFANPD GTFTQEMNAA PVRARKTDGA WAPIDTTLVR        60
     EADGSIRAKN TTAALTFSGG GSGTGLVTLK DDGHELKLGW PTELPEPRLD ANTATYADVL       120
     PAVDLKLTAL SSGYTSVLVV KTAQAAANPA LATIEMTISG GSLDIAATAD GGFVARDGDG       180
     TPVFESPAGR MWDSAGDNPA TASTTSARSA ASAESVVVPE AEGEPAPSEA PSSGDAEAEL       240
     PLKVTGTTME ITPDPALLKG KDTVFPLYID PPTKGIALGD WTALSSDGDK FWEFDGDKGV       300
     GRCSNHAGYL CSNSPYTQRL YFEYPLSSIH GKKILDATME VYQVWTFTCD PHWYDLSTVD       360
     KGITSSTTWS VRPKEINLMG DRNVAYGRGG LCDPSQPANW VRFSDNLDET NENLTPTLAS       420
     AAQNKTSQIT FSLTAHDESD AASWARFRND AKLSVTYVSY PSTPTSYGVQ QGTTGRACTA       480
     STLPFATSDT TPKMLAAVQS ADGSQSQLRA LFEVWKADGS SRAWYAASPD GAWVADNASR       540
     DATSSALPPQ TDYRMRVKTQ AYYKTDRGAT GVLDSSWSSW CYFRVDTDSP PPPIVASADG       600
     IYKPAATDPA AGGVGTPGKF TFTPGDTNAT TPGIQSDVVS YKWKLNSGAV SLSIPVAKGA       660
     PTTQSIAPNQ AGENTIQVWG FDAAGHSSLT GYYSFLVKGA EKPSGVWHLD NALTDSTTAT       720
     PHALTASGVT WDAKSRSGAS ALKFNGTTGY AQSSGPVVDT TKSFSLSAWA RLSDLSRSQT       780
     IVSQQATTLS GFALHYSATS QRFAFSRYHS DVASPAASRS TAATAPVANA WTHLTGVYDA       840
     AGQTVQLFVN GRPQGQPVPF TTPWLATGSL QIGRFHNSTG YVEHFSGVAD EVKVWARALA       900
     DTEVAHDAWL EDEDLSDGTA GDPVPALVAE WDAMDMINAT GATIRDTSDF GRNLTLNGAV       960
     LTKFTTGDPE LGEEVTTTQT MTLNGTSAYA TAPGPIVDDS GSFTATAWVT LDPAKFTDTS      1020
     KSYAVQVFGQ SGANQSSWGV WYEQPAGSTQ GRWTFGRPDK DGTGAAWTRS DSTAFTTAQL      1080
     GVPVMLTVVY DAQAAANPDD TSKLGGLKLH VDSARMGDED GVAYSAPWQG SGVFEIGRAK      1140
     INGAAARHFP GKINSVRVWA GSTSTGTIAN RYNTEQQFQQ                            1180
//

If you have problems or comments...

PBIL Back to PBIL home page