(data stored in ACNUC7421 zone)

EMBL: AP009493.PE90

AP009493.PE90        Location/Qualifiers
FT   CDS             90254..90799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_90t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_90t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16919"
FT                   /db_xref="GOA:B1VM18"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM18"
FT                   /protein_id="BAG16919.1"
FT                   /translation="MAATARQRLAAALSYLQRKSGLSIRVIADRTMLSPSFISRILSGE
FT                   RLPSWDLVCHLCSILGHEPGELRLLCEAAHGIEQPPRQTVTEYIAALKAALRGLHLAAA
FT                   RPTPDEIHRRSHGLVPVQVVAQVLRGDAVPEWEVVGALVTALGGQAADFKPLWEAIHYS
FT                   FLMTDDPCVSDLVSETTG"
     MAATARQRLA AALSYLQRKS GLSIRVIADR TMLSPSFISR ILSGERLPSW DLVCHLCSIL        60
     GHEPGELRLL CEAAHGIEQP PRQTVTEYIA ALKAALRGLH LAAARPTPDE IHRRSHGLVP       120
     VQVVAQVLRG DAVPEWEVVG ALVTALGGQA ADFKPLWEAI HYSFLMTDDP CVSDLVSETT       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page