(data stored in ACNUC7421 zone)

EMBL: AP009493.PE92

AP009493.PE92        Location/Qualifiers
FT   CDS             91423..92244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_92t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_92t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16921"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1VN98"
FT                   /protein_id="BAG16921.1"
FT                   /translation="MTAENQLPYGVDVRTPSVARMYDHLLDGKDNFSADRAACDHLLQQ
FT                   VPSMKDLALNNRAFLQRVVRTLAREYGIRQFIDHGSGLPTQDNVHQIAQRVDGASRVVY
FT                   VDSDPIVRSVGGALLETDDRTAVLQADMRDTQEIFDSEPVRRLIDFREPVGALFVSVLH
FT                   CIPDADRPVDLIRRVRSRLASGSVMVICQLVSESEQVRDEVSAFMDRETRGHWGRVRTR
FT                   ADVESYFEDNGLSVVEPGLVEVSRWRPADVPAAPPQQSFEWEEFGGAGLVP"
     MTAENQLPYG VDVRTPSVAR MYDHLLDGKD NFSADRAACD HLLQQVPSMK DLALNNRAFL        60
     QRVVRTLARE YGIRQFIDHG SGLPTQDNVH QIAQRVDGAS RVVYVDSDPI VRSVGGALLE       120
     TDDRTAVLQA DMRDTQEIFD SEPVRRLIDF REPVGALFVS VLHCIPDADR PVDLIRRVRS       180
     RLASGSVMVI CQLVSESEQV RDEVSAFMDR ETRGHWGRVR TRADVESYFE DNGLSVVEPG       240
     LVEVSRWRPA DVPAAPPQQS FEWEEFGGAG LVP                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page