(data stored in ACNUC7421 zone)

EMBL: AP009493.PE93

AP009493.PE93        Location/Qualifiers
FT   CDS             complement(92263..93192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_93t"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_93t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16922"
FT                   /db_xref="GOA:B1VN99"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1VN99"
FT                   /protein_id="BAG16922.1"
FT                   /translation="MTGQHGDNRSIRGFAPRPHLGAAAHRRALGEHLRRCRTGIGMTGK
FT                   AAARHIGTSGPTVSRLEKGERTENTGQHATALLRLCGVTDRQELSHALSIAAQGEKPDA
FT                   WEAYGNSIARWVQPLLALEPAAQRIMAYEPQLVPGWLQTTEYAQLVIRAGFPDLSQAEV
FT                   EARARARTNRLSMFHRDQDPPAMVAIMDEDVLRRPVGSPGVLYRQIEHLIQLLKSDLRH
FT                   RINLHIAPLSMGMTGAVGHPIVHLRFADALLSDFVYLEQSEGARCVEGEGEAERYLSRV
FT                   TTLSGMANPAALTLTQLEDRLDELATGR"
     MTGQHGDNRS IRGFAPRPHL GAAAHRRALG EHLRRCRTGI GMTGKAAARH IGTSGPTVSR        60
     LEKGERTENT GQHATALLRL CGVTDRQELS HALSIAAQGE KPDAWEAYGN SIARWVQPLL       120
     ALEPAAQRIM AYEPQLVPGW LQTTEYAQLV IRAGFPDLSQ AEVEARARAR TNRLSMFHRD       180
     QDPPAMVAIM DEDVLRRPVG SPGVLYRQIE HLIQLLKSDL RHRINLHIAP LSMGMTGAVG       240
     HPIVHLRFAD ALLSDFVYLE QSEGARCVEG EGEAERYLSR VTTLSGMANP AALTLTQLED       300
     RLDELATGR                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page