(data stored in ACNUC7421 zone)

EMBL: AP009493.PE94

AP009493.PE94        Location/Qualifiers
FT   CDS             complement(93285..93518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_94t"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_94t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16923"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNA0"
FT                   /protein_id="BAG16923.1"
FT                   /translation="MTVQLNGVSAETITGAVWRKSARSNAAGNCVEVARLEGGEIAMRN
FT                   SRFPEGPALVYTPAEMESFLLGVKDGEFDFAL"
     MTVQLNGVSA ETITGAVWRK SARSNAAGNC VEVARLEGGE IAMRNSRFPE GPALVYTPAE        60
     MESFLLGVKD GEFDFAL                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page