(data stored in ACNUC7421 zone)

EMBL: AP009493.PE96

AP009493.PE96        Location/Qualifiers
FT   CDS             complement(94323..94898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_96t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_96t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16925"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNA2"
FT                   /protein_id="BAG16925.1"
FT                   /translation="MSGNLPAQSVTADYAQRVADDLAANRSDQERVRTELARLQDELVR
FT                   LEDSEQVLTKMQDVLGGMPKQTAKQRKDRKGASVPAARGSNRKTAAGKPAAAAGRKASK
FT                   KTVSPKKAGEPTWLELTTAYLGGQSEPRSAAEVAASLTEAHPERTVQVTVVRNSLEQGV
FT                   AQGLLERSKQGRSVFYSPTAPASAPSGS"
     MSGNLPAQSV TADYAQRVAD DLAANRSDQE RVRTELARLQ DELVRLEDSE QVLTKMQDVL        60
     GGMPKQTAKQ RKDRKGASVP AARGSNRKTA AGKPAAAAGR KASKKTVSPK KAGEPTWLEL       120
     TTAYLGGQSE PRSAAEVAAS LTEAHPERTV QVTVVRNSLE QGVAQGLLER SKQGRSVFYS       180
     PTAPASAPSG S                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page