(data stored in ACNUC7421 zone)

EMBL: AP009493.PE99

AP009493.PE99        Location/Qualifiers
FT   CDS             98941..99441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_99t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_99t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16928"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNA5"
FT                   /protein_id="BAG16928.1"
FT                   /translation="MNTARLEGWANELKVLVAEDAAQECEAAQRLDAAARLMEAAQEDA
FT                   DIAADKARSSRNALAMVTEQIRRSLPDSGEADADPGAAERQQENPAPHAPSSVAGVILS
FT                   FLRNQSEATYGEITNQVRRMRPDVVAENCARDLGRLVNRGLLVRPRLGVYRLAGTQDEP
FT                   MNS"
     MNTARLEGWA NELKVLVAED AAQECEAAQR LDAAARLMEA AQEDADIAAD KARSSRNALA        60
     MVTEQIRRSL PDSGEADADP GAAERQQENP APHAPSSVAG VILSFLRNQS EATYGEITNQ       120
     VRRMRPDVVA ENCARDLGRL VNRGLLVRPR LGVYRLAGTQ DEPMNS                      166
//

If you have problems or comments...

PBIL Back to PBIL home page