(data stored in ACNUC7421 zone)

EMBL: AP009493.TEBC

AP009493.TEBC        Location/Qualifiers
FT   CDS             704021..704488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tebC"
FT                   /locus_tag="SGR_604"
FT                   /product="putative enediyne biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_604"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17433"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL5"
FT                   /protein_id="BAG17433.1"
FT                   /translation="MADARPYYELRHLVGFEETNLVGNVYYVNYVRWQGRCREMFLLDR
FT                   APEVLDDIRDDLKLFTVSVGCEFFAEITAFDQLSIRMRLEELTQTQIVFTFDYLRLHED
FT                   TENLVARGRQRVACMRGPNGDTRPTRVPEALRQALEPYAARVSAAVPASGG"
     MADARPYYEL RHLVGFEETN LVGNVYYVNY VRWQGRCREM FLLDRAPEVL DDIRDDLKLF        60
     TVSVGCEFFA EITAFDQLSI RMRLEELTQT QIVFTFDYLR LHEDTENLVA RGRQRVACMR       120
     GPNGDTRPTR VPEALRQALE PYAARVSAAV PASGG                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page