(data stored in ACNUC7421 zone)

EMBL: AP009493.UNBL1

AP009493.UNBL1       Location/Qualifiers
FT   CDS             704642..705625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="unbL1"
FT                   /locus_tag="SGR_605"
FT                   /product="putative enediyne biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_605"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17434"
FT                   /db_xref="InterPro:IPR012964"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL6"
FT                   /protein_id="BAG17434.1"
FT                   /translation="MASAMGSLRRLLMAPSLRDVSFAGRGFPVTETAATRQLETIPQAV
FT                   VTGFEWGIESTSLWETERRLSLVDLEMQGFAYEGAVMASVIRDSMPGRGGRTRALLQGS
FT                   GRRHIFLNYIGIGFAMAKLPRPLWGKVMPDDLDGEEFYPPMSWLAIDGYGFDRAYFDRA
FT                   RWVDAQRPDTPYAWEGHPHYFQRAVDQGIGRALWFIHGAGVAQVSAAVRGFAPERAPDL
FT                   WAGVGLAATFAGCSTAAELASLRAESGELRGHVAQGSVFAAKARHFSGVVPEHTRAALH
FT                   ALAGITVEAAAALADDTAPAPGSARDVPAYEIWRRTVRAQLLAPTD"
     MASAMGSLRR LLMAPSLRDV SFAGRGFPVT ETAATRQLET IPQAVVTGFE WGIESTSLWE        60
     TERRLSLVDL EMQGFAYEGA VMASVIRDSM PGRGGRTRAL LQGSGRRHIF LNYIGIGFAM       120
     AKLPRPLWGK VMPDDLDGEE FYPPMSWLAI DGYGFDRAYF DRARWVDAQR PDTPYAWEGH       180
     PHYFQRAVDQ GIGRALWFIH GAGVAQVSAA VRGFAPERAP DLWAGVGLAA TFAGCSTAAE       240
     LASLRAESGE LRGHVAQGSV FAAKARHFSG VVPEHTRAAL HALAGITVEA AAALADDTAP       300
     APGSARDVPA YEIWRRTVRA QLLAPTD                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page