(data stored in ACNUC7421 zone)

EMBL: AP009493.UNBL2

AP009493.UNBL2       Location/Qualifiers
FT   CDS             705717..706685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="unbL2"
FT                   /locus_tag="SGR_606"
FT                   /product="putative enediyne biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_606"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17435"
FT                   /db_xref="InterPro:IPR012964"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL7"
FT                   /protein_id="BAG17435.1"
FT                   /translation="MSILRAMRRRVLTPNVRETKLEKRGFHVKNAAAKHQLETVGTSFL
FT                   QGYAYAVEARTADQATDWLETVPRPFRGFAYEGAGMGAVMLDSLTGGDKRLTGILEGRG
FT                   RHHNYMIYVGVGWAMARLPRFMWPDVSSTDPVLRWLLLDGYGFHQAYFKTDAYVRDPGR
FT                   EHPFTWKGGPDAYSARVIDQGIGRALWFVGGTDPDVVAELIGAYPAHRHGDMYAGAGLA
FT                   CTYAGSVDEDELRRFAKHAGEHLPNLAQGSAFACEARERAGTTTAHTHLAARVLCGGRT
FT                   PGEAARVCADTAPESCDGGEIPAFEIWRQHIAAEITSVPHA"
     MSILRAMRRR VLTPNVRETK LEKRGFHVKN AAAKHQLETV GTSFLQGYAY AVEARTADQA        60
     TDWLETVPRP FRGFAYEGAG MGAVMLDSLT GGDKRLTGIL EGRGRHHNYM IYVGVGWAMA       120
     RLPRFMWPDV SSTDPVLRWL LLDGYGFHQA YFKTDAYVRD PGREHPFTWK GGPDAYSARV       180
     IDQGIGRALW FVGGTDPDVV AELIGAYPAH RHGDMYAGAG LACTYAGSVD EDELRRFAKH       240
     AGEHLPNLAQ GSAFACEARE RAGTTTAHTH LAARVLCGGR TPGEAARVCA DTAPESCDGG       300
     EIPAFEIWRQ HIAAEITSVP HA                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page