(data stored in ACNUC7421 zone)

EMBL: AP009493.UNBU

AP009493.UNBU        Location/Qualifiers
FT   CDS             708626..709780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="unbU"
FT                   /locus_tag="SGR_608"
FT                   /product="putative enediyne biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_608"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17437"
FT                   /db_xref="GOA:B1VRL9"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL9"
FT                   /protein_id="BAG17437.1"
FT                   /translation="MTVPETRTRAAAAPRHDVKVVTALRRFAISISILNIAGYTFLGFE
FT                   QPWLWPFIAVLTAYTVEIALEAVSARGEKRAPRYAGGGFKGMVEFLFPAHITGLAVNML
FT                   TYVNDRVWVMVFGVVVAVGTKWVLRAPLKGRMRHYMNPSNFGIAVILLLFPWASIAPPY
FT                   HFTEYLYGPADWVLPAIILVLGTMLNAKLTGRMWLIGAWLIGFVLQAVIRGLVTGTSIP
FT                   AALGMMTGVAFILFTNYMVTDPGTSPSRRSSQIAFGGGVAAMYGVLTALGIAYGIFFAT
FT                   ALVCLIRGGYLWGLHVKAKQAPAAAEPAQRAQAQRAQAEPAEQTAASAPPPLPTPAPEP
FT                   EPAHAATVAAARTGDPCRDGTCLHGKCASMRAAAQQRKKMAVPV"
     MTVPETRTRA AAAPRHDVKV VTALRRFAIS ISILNIAGYT FLGFEQPWLW PFIAVLTAYT        60
     VEIALEAVSA RGEKRAPRYA GGGFKGMVEF LFPAHITGLA VNMLTYVNDR VWVMVFGVVV       120
     AVGTKWVLRA PLKGRMRHYM NPSNFGIAVI LLLFPWASIA PPYHFTEYLY GPADWVLPAI       180
     ILVLGTMLNA KLTGRMWLIG AWLIGFVLQA VIRGLVTGTS IPAALGMMTG VAFILFTNYM       240
     VTDPGTSPSR RSSQIAFGGG VAAMYGVLTA LGIAYGIFFA TALVCLIRGG YLWGLHVKAK       300
     QAPAAAEPAQ RAQAQRAQAE PAEQTAASAP PPLPTPAPEP EPAHAATVAA ARTGDPCRDG       360
     TCLHGKCASM RAAAQQRKKM AVPV                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page