(data stored in ACNUC7421 zone)

EMBL: AP009493.UNBV

AP009493.UNBV        Location/Qualifiers
FT   CDS             706698..708629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="unbV"
FT                   /locus_tag="SGR_607"
FT                   /product="putative enediyne biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_607"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17436"
FT                   /db_xref="InterPro:IPR011519"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL8"
FT                   /protein_id="BAG17436.1"
FT                   /translation="MTHPISWLRKQAPGVIALALMVSTFYVVKPYESSAADKAELAEKF
FT                   TFEPMAISMPGGYRKQSVRKVNKAYKHIEAWISSVGAGVAMNDIDGDGLPNDLCITDPQ
FT                   IDQAVVTPAPAPGRESASYAPFTLDMSPLPKSDIMAPIGCVPGDYNEDGAMDLLVYYWG
FT                   RTPVIFQAKKEPGKDTTTMDPKCFEPVELVPGNGGGGEYDGPLWNSNAATVADFDGDGH
FT                   NDIYIGNYFPDSPVLDDTVHGGVTMNDSLSHAQNGGGGHFFRWTPSGYEQVEGVLPKGI
FT                   DQGWTLAVSATDLDGDQRPEMYLAHDFGTSALLYNRSTPGTFKFSEVKAKHTATTPKSK
FT                   EIGRSSFKGMGIDFGDLDNDGLYDAFVSNITTSFGIQESNFAFIGTARDKADLRAKFRD
FT                   GVAPYKDESAPLNLAWSGWGWDVKMGDFDNDGIQEITQAVGFVKGKRNRWAQLQELATA
FT                   NDALVKHPRFWPRVEEGDDLAGDQHMRFFVQEKDGEAYSDLSKQLGLAVPVPSRGIATG
FT                   DADGDGRLDMVVARQWEDPVFYCNMSRKTGGHLNLSLTDAAGSPVIGAQVTVTLSDGST
FT                   RLGRVDGGSGHSGKRSQDVHIGLGQEAEGPMQTRLTWRDRTGQVRNKDLQLTPGRHALE
FT                   LGADVKEK"
     MTHPISWLRK QAPGVIALAL MVSTFYVVKP YESSAADKAE LAEKFTFEPM AISMPGGYRK        60
     QSVRKVNKAY KHIEAWISSV GAGVAMNDID GDGLPNDLCI TDPQIDQAVV TPAPAPGRES       120
     ASYAPFTLDM SPLPKSDIMA PIGCVPGDYN EDGAMDLLVY YWGRTPVIFQ AKKEPGKDTT       180
     TMDPKCFEPV ELVPGNGGGG EYDGPLWNSN AATVADFDGD GHNDIYIGNY FPDSPVLDDT       240
     VHGGVTMNDS LSHAQNGGGG HFFRWTPSGY EQVEGVLPKG IDQGWTLAVS ATDLDGDQRP       300
     EMYLAHDFGT SALLYNRSTP GTFKFSEVKA KHTATTPKSK EIGRSSFKGM GIDFGDLDND       360
     GLYDAFVSNI TTSFGIQESN FAFIGTARDK ADLRAKFRDG VAPYKDESAP LNLAWSGWGW       420
     DVKMGDFDND GIQEITQAVG FVKGKRNRWA QLQELATAND ALVKHPRFWP RVEEGDDLAG       480
     DQHMRFFVQE KDGEAYSDLS KQLGLAVPVP SRGIATGDAD GDGRLDMVVA RQWEDPVFYC       540
     NMSRKTGGHL NLSLTDAAGS PVIGAQVTVT LSDGSTRLGR VDGGSGHSGK RSQDVHIGLG       600
     QEAEGPMQTR LTWRDRTGQV RNKDLQLTPG RHALELGADV KEK                         643
//

If you have problems or comments...

PBIL Back to PBIL home page