(data stored in ACNUC7421 zone)

EMBL: AP009493.UREA3

AP009493.UREA3       Location/Qualifiers
FT   CDS             complement(254882..255184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureA3"
FT                   /locus_tag="SGR_238"
FT                   /product="putative urease gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_238"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17067"
FT                   /db_xref="GOA:B1VNP4"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNP4"
FT                   /protein_id="BAG17067.1"
FT                   /translation="MFLTPSDTEKLLLSVAGMIARDRRARGVRLNYPETVALLACWAME
FT                   RAREGAPVSELMTAGRSVLTRAEVLEGVPEMLHDVQVEATFPDGRKLVTITSPIP"
     MFLTPSDTEK LLLSVAGMIA RDRRARGVRL NYPETVALLA CWAMERAREG APVSELMTAG        60
     RSVLTRAEVL EGVPEMLHDV QVEATFPDGR KLVTITSPIP                             100
//

If you have problems or comments...

PBIL Back to PBIL home page