(data stored in ACNUC7421 zone)

EMBL: AP009493.UREB3

AP009493.UREB3       Location/Qualifiers
FT   CDS             complement(254547..254885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureB3"
FT                   /locus_tag="SGR_237"
FT                   /product="putative urease beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_237"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17066"
FT                   /db_xref="GOA:B1VNP3"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNP3"
FT                   /protein_id="BAG17066.1"
FT                   /translation="MIPGEIRTGSGVLHINAESAALPLTVVNDGDRPIQVGSHLHFSDA
FT                   NPALSFDRAAARGFRLDIPSGTSLRFEPGVGVDVSLVELRGRRRVPGIVPPGTRDPASL
FT                   PTPRTEEP"
     MIPGEIRTGS GVLHINAESA ALPLTVVNDG DRPIQVGSHL HFSDANPALS FDRAAARGFR        60
     LDIPSGTSLR FEPGVGVDVS LVELRGRRRV PGIVPPGTRD PASLPTPRTE EP               112
//

If you have problems or comments...

PBIL Back to PBIL home page