(data stored in ACNUC7421 zone)

EMBL: AP009493.UREC3

AP009493.UREC3       Location/Qualifiers
FT   CDS             complement(252842..254545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureC3"
FT                   /locus_tag="SGR_236"
FT                   /product="putative urease alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_236"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17065"
FT                   /db_xref="GOA:B1VNP2"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNP2"
FT                   /protein_id="BAG17065.1"
FT                   /translation="MAQLTRAAYASLYGPTTGDRIRLADTDLWIEVEEDRCFGGDEAVF
FT                   GGGKSIRESMAQATASRAEGAPDLVITNAVVLDHWGVVKTDVGVRDGRIVALGRSGNPD
FT                   ISDGVHPDLVIGPGTDVISGEGRILTAGAVDTHVHFLMPETLHEALATGTTTVIGGGTG
FT                   ATEGSKATTVTPGAWNLAMMHRSLDRVPLNVMLFGKGSTVGEEALREAALSGAGGYKVH
FT                   EDWGATPAAIDAALRAADAYGLQVALHADSLNEVGYVEGTLDAIAGRGIHVFHAEGAGG
FT                   GHAPDIITVASHPNILPASTNPTLPHTVNTVAEHLDMLMVCHHLNPRVPEDLAFAESRI
FT                   RATTIAAEDVLHDIGALSITSSDAQAMGRIGEVVCRTWQVAHVMKQRFGDRDSELPADN
FT                   ERARRYVAKYTICPAVAHGIDHVVGSVEPGKLADLVLWDPAFFGIRPAAVIKGGMAVYA
FT                   PLGDAGAAIPTTQPVLLRATSAAEAAPHLSVSFVSPLALADGLAERLGLERELVAIRPT
FT                   RHLTKADLPNNTALPAIDVDPETFAIRIDGELVEPAPAAELPLAQRYSMF"
     MAQLTRAAYA SLYGPTTGDR IRLADTDLWI EVEEDRCFGG DEAVFGGGKS IRESMAQATA        60
     SRAEGAPDLV ITNAVVLDHW GVVKTDVGVR DGRIVALGRS GNPDISDGVH PDLVIGPGTD       120
     VISGEGRILT AGAVDTHVHF LMPETLHEAL ATGTTTVIGG GTGATEGSKA TTVTPGAWNL       180
     AMMHRSLDRV PLNVMLFGKG STVGEEALRE AALSGAGGYK VHEDWGATPA AIDAALRAAD       240
     AYGLQVALHA DSLNEVGYVE GTLDAIAGRG IHVFHAEGAG GGHAPDIITV ASHPNILPAS       300
     TNPTLPHTVN TVAEHLDMLM VCHHLNPRVP EDLAFAESRI RATTIAAEDV LHDIGALSIT       360
     SSDAQAMGRI GEVVCRTWQV AHVMKQRFGD RDSELPADNE RARRYVAKYT ICPAVAHGID       420
     HVVGSVEPGK LADLVLWDPA FFGIRPAAVI KGGMAVYAPL GDAGAAIPTT QPVLLRATSA       480
     AEAAPHLSVS FVSPLALADG LAERLGLERE LVAIRPTRHL TKADLPNNTA LPAIDVDPET       540
     FAIRIDGELV EPAPAAELPL AQRYSMF                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page