(data stored in ACNUC7421 zone)

EMBL: AP009493.URED3

AP009493.URED3       Location/Qualifiers
FT   CDS             complement(250668..251435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureD3"
FT                   /locus_tag="SGR_233"
FT                   /product="putative urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_233"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17062"
FT                   /db_xref="GOA:B1VNN9"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1VNN9"
FT                   /protein_id="BAG17062.1"
FT                   /translation="MTGPPAPAARPAEPDDPTVVAVERDASGRHLARELSPGAFLAPRP
FT                   LLPCADRLRIALVGTRAGLLAGDDLRLHVSVGPGARLDLVEPSGLVAYDHRGGRSAWRA
FT                   RIDIAAGGRLDWDGKPFVVAHGAWVDRTMEVTLAPGARMLWRDTLVLGRSGERGGRVRT
FT                   RTRAEYDGRELLVEDLDLTDPDIRELPGVLGPNRIVGSVTALGTRPPGPPHPYRTDLAG
FT                   PGAQVRLLDTEAPAMEAELSALCEHWRTENDHA"
     MTGPPAPAAR PAEPDDPTVV AVERDASGRH LARELSPGAF LAPRPLLPCA DRLRIALVGT        60
     RAGLLAGDDL RLHVSVGPGA RLDLVEPSGL VAYDHRGGRS AWRARIDIAA GGRLDWDGKP       120
     FVVAHGAWVD RTMEVTLAPG ARMLWRDTLV LGRSGERGGR VRTRTRAEYD GRELLVEDLD       180
     LTDPDIRELP GVLGPNRIVG SVTALGTRPP GPPHPYRTDL AGPGAQVRLL DTEAPAMEAE       240
     LSALCEHWRT ENDHA                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page