(data stored in ACNUC7421 zone)

EMBL: AP009493.UREF3

AP009493.UREF3       Location/Qualifiers
FT   CDS             complement(252177..252842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureF3"
FT                   /locus_tag="SGR_235"
FT                   /product="putative urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_235"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17064"
FT                   /db_xref="GOA:B1VNP1"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNP1"
FT                   /protein_id="BAG17064.1"
FT                   /translation="MALLAPYLLADGRLPVGAHTYSAGLEPAVAAGLTRAQIPALLRAR
FT                   LHTTVVTEAAATALALRAALRAPVDFAPVQEALAARTPTAPLREASAALGRGVHRLARR
FT                   LDPDHPAVTALARIRPRPLRPVTLGALGAVLGVGEEELVHGVVYDELQTIASAALKLLP
FT                   GDPLDSVAWIVAAEADAARTVTEALAVRTPAELPARTPPLTEQWALEHDRRERRLFLA"
     MALLAPYLLA DGRLPVGAHT YSAGLEPAVA AGLTRAQIPA LLRARLHTTV VTEAAATALA        60
     LRAALRAPVD FAPVQEALAA RTPTAPLREA SAALGRGVHR LARRLDPDHP AVTALARIRP       120
     RPLRPVTLGA LGAVLGVGEE ELVHGVVYDE LQTIASAALK LLPGDPLDSV AWIVAAEADA       180
     ARTVTEALAV RTPAELPART PPLTEQWALE HDRRERRLFL A                           221
//

If you have problems or comments...

PBIL Back to PBIL home page