(data stored in ACNUC7421 zone)

EMBL: AP010803.ACPS

AP010803.ACPS        Location/Qualifiers
FT   CDS             complement(670743..671144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="SJA_C1-06660"
FT                   /product="holo-[acyl-carrier-protein] synthase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95500"
FT                   /db_xref="GOA:D4YYR8"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYR8"
FT                   /protein_id="BAI95500.1"
FT                   /translation="MIVGLGSDLCNIERIENSLDRFGERFEKRVFTDVEQAKANRRPFT
FT                   KAGTLAKRFAAKEAFSKAVGTGFKQGVFMKDIGVVNGPSGAPTLHLTGGALARLESLVP
FT                   AGHRPVVHLTLTDDHPWAQAFVIIEALPL"
     MIVGLGSDLC NIERIENSLD RFGERFEKRV FTDVEQAKAN RRPFTKAGTL AKRFAAKEAF        60
     SKAVGTGFKQ GVFMKDIGVV NGPSGAPTLH LTGGALARLE SLVPAGHRPV VHLTLTDDHP       120
     WAQAFVIIEA LPL                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page