(data stored in ACNUC7421 zone)

EMBL: AP010803.ADK

AP010803.ADK         Location/Qualifiers
FT   CDS             654683..655348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SJA_C1-06480"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95482"
FT                   /db_xref="GOA:D4YYQ0"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="InterPro:IPR036193"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ0"
FT                   /protein_id="BAI95482.1"
FT                   /translation="MRDMNIILLGPPGAGKGTQATRLVDSRAMVQLSTGDMLRAAVKAG
FT                   TPIGLKAKAVMEAGELVSDEIVSGIIGEALDALAPETGVIFDGYPRTEAQAHSLDGILA
FT                   DRNRTLDHVIELEVDEDALVERITGRFTCATCGEGYHDRFKTPKVEGACDKCGGHEFKR
FT                   RPDDNEETVRTRMAEYRAKTAPILPIYEARGIVSRVDGMADMDDVTVAIAAILDGKAA"
     MRDMNIILLG PPGAGKGTQA TRLVDSRAMV QLSTGDMLRA AVKAGTPIGL KAKAVMEAGE        60
     LVSDEIVSGI IGEALDALAP ETGVIFDGYP RTEAQAHSLD GILADRNRTL DHVIELEVDE       120
     DALVERITGR FTCATCGEGY HDRFKTPKVE GACDKCGGHE FKRRPDDNEE TVRTRMAEYR       180
     AKTAPILPIY EARGIVSRVD GMADMDDVTV AIAAILDGKA A                           221
//

If you have problems or comments...

PBIL Back to PBIL home page