(data stored in ACNUC7421 zone)

EMBL: AP010803.ARGB

AP010803.ARGB        Location/Qualifiers
FT   CDS             complement(684565..685482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="SJA_C1-06840"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95518"
FT                   /db_xref="GOA:D4YYT6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYT6"
FT                   /protein_id="BAI95518.1"
FT                   /translation="MRPRMNSKHSPDPALLAKAETLVEALPYMQRYAGKTFVVKYGGHA
FT                   MGDPEAARDFAEDVVLMKAVGINVVVVHGGGPQIGAMLKKLGVESQFVGGLRVTDKETA
FT                   QIAEMVLAGSINKEIVGWISGAGGRAVGISGKDGGLVLCEKVLGKREADPNSGIERNVD
FT                   LGFVGDPVRVDRSILDTLTQNGIIPVVAPVGIGADGHTYNVNADTMAGAIAAELQAARF
FT                   FLLTDVAGVLDKQGQLLTDLDPEAINGLEADGTISGGMIPKLETCVRAVEGGVDAAVIL
FT                   DGRVPHAMLLEIFTDRGAGTLVRR"
     MRPRMNSKHS PDPALLAKAE TLVEALPYMQ RYAGKTFVVK YGGHAMGDPE AARDFAEDVV        60
     LMKAVGINVV VVHGGGPQIG AMLKKLGVES QFVGGLRVTD KETAQIAEMV LAGSINKEIV       120
     GWISGAGGRA VGISGKDGGL VLCEKVLGKR EADPNSGIER NVDLGFVGDP VRVDRSILDT       180
     LTQNGIIPVV APVGIGADGH TYNVNADTMA GAIAAELQAA RFFLLTDVAG VLDKQGQLLT       240
     DLDPEAINGL EADGTISGGM IPKLETCVRA VEGGVDAAVI LDGRVPHAML LEIFTDRGAG       300
     TLVRR                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page