(data stored in ACNUC7421 zone)

EMBL: AP010803.ARSC

AP010803.ARSC        Location/Qualifiers
FT   CDS             441542..442078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="SJA_C1-04240"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="protein-tyrosine-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95258"
FT                   /db_xref="GOA:D4YY26"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY26"
FT                   /protein_id="BAI95258.1"
FT                   /translation="MTDRLLNVLFLCTGNSARSIMAEAILSREGLGRFKSFSAGSQPKG
FT                   EVHPFTIHLLEKLNYDASRFRSKSWEEFSGPDAPSLDFVFTVCDNAANELCPVWPGQPL
FT                   TANWGVPDPAAIEDSETVQHAAFFDTYRMLFNRISLFTNLPFEGLDKMSLQNRLNRIGK
FT                   EQGRADLPSEKAPSA"
     MTDRLLNVLF LCTGNSARSI MAEAILSREG LGRFKSFSAG SQPKGEVHPF TIHLLEKLNY        60
     DASRFRSKSW EEFSGPDAPS LDFVFTVCDN AANELCPVWP GQPLTANWGV PDPAAIEDSE       120
     TVQHAAFFDT YRMLFNRISL FTNLPFEGLD KMSLQNRLNR IGKEQGRADL PSEKAPSA         178
//

If you have problems or comments...

PBIL Back to PBIL home page