(data stored in SCRATCH zone)

EMBL: AP010803.ARSH

AP010803.ARSH        Location/Qualifiers
FT   CDS             444007..444747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsH"
FT                   /locus_tag="SJA_C1-04280"
FT                   /product="arylsulfatase-family protein"
FT                   /note="putative flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95262"
FT                   /db_xref="GOA:D4YY30"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY30"
FT                   /protein_id="BAI95262.1"
FT                   /translation="MSRLRILPEPDHMPALDRAMIRPDLAAGLGALEPKPRILLLYGSL
FT                   RERSFSRFAVEEAARLLILFGAEVRIFDPADLPLPDQIKDDDHPAVHELREHALWSEGM
FT                   VWCSPERHGQITGIMKAQIDHLPLEFGGMRPTQGRTLAVMQVSGGSQSFNAVNTLRLLG
FT                   RWMRMFTIPNQSSIAMAFKEFDEDGRLSASSYYDRIVDVMEELVRFTVLTRRHADQLVD
FT                   RYSERKAAAAKRDAAQDLASRSKA"
     MSRLRILPEP DHMPALDRAM IRPDLAAGLG ALEPKPRILL LYGSLRERSF SRFAVEEAAR        60
     LLILFGAEVR IFDPADLPLP DQIKDDDHPA VHELREHALW SEGMVWCSPE RHGQITGIMK       120
     AQIDHLPLEF GGMRPTQGRT LAVMQVSGGS QSFNAVNTLR LLGRWMRMFT IPNQSSIAMA       180
     FKEFDEDGRL SASSYYDRIV DVMEELVRFT VLTRRHADQL VDRYSERKAA AAKRDAAQDL       240
     ASRSKA                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page