(data stored in ACNUC7421 zone)

EMBL: AP010803.BACA

AP010803.BACA        Location/Qualifiers
FT   CDS             complement(259546..260355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="SJA_C1-02430"
FT                   /product="undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="undecaprenol kinase, putative / uncharacterized
FT                   bacitracin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95077"
FT                   /db_xref="GOA:D4YXJ5"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXJ5"
FT                   /protein_id="BAI95077.1"
FT                   /translation="MDLHYLTVILLGIVEGLTEFLPVSSTGHLILASELLGYDASTWAM
FT                   FNVVIQLGAILAVVVLYWRTFWAVGMGLLRREPASWRFLRNLLVAFIPAAVIGLALHNY
FT                   IEELLGAPRVVAWALIAGGIAILGIERMVKENRFHGIADIPFVRVVGIGFIQCLAMIPG
FT                   ISRSGATIMGALTLGVERRTAAEFSFFLAIPTMLGATTLELLKNGDKLTSATVGWGSIV
FT                   LGFIVSFIVALLVIKWFVGLVSRHGFAPFAWYRIVAGIAALAWLSLR"
     MDLHYLTVIL LGIVEGLTEF LPVSSTGHLI LASELLGYDA STWAMFNVVI QLGAILAVVV        60
     LYWRTFWAVG MGLLRREPAS WRFLRNLLVA FIPAAVIGLA LHNYIEELLG APRVVAWALI       120
     AGGIAILGIE RMVKENRFHG IADIPFVRVV GIGFIQCLAM IPGISRSGAT IMGALTLGVE       180
     RRTAAEFSFF LAIPTMLGAT TLELLKNGDK LTSATVGWGS IVLGFIVSFI VALLVIKWFV       240
     GLVSRHGFAP FAWYRIVAGI AALAWLSLR                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page