(data stored in ACNUC7421 zone)

EMBL: AP010803.BCR

AP010803.BCR         Location/Qualifiers
FT   CDS             complement(76564..77838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcr"
FT                   /locus_tag="SJA_C1-00730"
FT                   /product="putative MFS permease"
FT                   /note="permease of the major facilitator superfamily, DHA1
FT                   family / bicyclomycin/chloramphenicol resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94907"
FT                   /db_xref="GOA:D4YX25"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX25"
FT                   /protein_id="BAI94907.1"
FT                   /translation="MTEHPDTAAAQPKRDMAFREFVMLCACLMAMNALSIDPMLPALPD
FT                   IGRDLSVPHPNDRQLIISVYFLGLGVGSLLFGVLSDRYGRKRVLGGAMALFILSSIACA
FT                   GAHSFAMMLAARACAGFFAGASRVITVGIVRDRFRGDAMARVMSLIFAVFMLIPVMAPT
FT                   FGQAILWIAPWRWIFWALAILATLILLWMGMRLPETLLPENRLRMSAGTIFRTVGTIVR
FT                   TRTSIGYMLASGVVMSGLIGFILSVQQIFFDIFGAQGIFPFAFAAMAGSMGVGSLLNSR
FT                   LVSRFGARRLSQTALLCLVSINVVHLAVILAGHETIVSFMILQAATMMTIAFTASNFSA
FT                   ISMEPFAKGAGVASSFQAFLTTAVSSALGSLIGQAFNGTTLPLTLGLAVFGSVSFLIVA
FT                   WAERGNLFTRPHHGALRDPEFEPLH"
     MTEHPDTAAA QPKRDMAFRE FVMLCACLMA MNALSIDPML PALPDIGRDL SVPHPNDRQL        60
     IISVYFLGLG VGSLLFGVLS DRYGRKRVLG GAMALFILSS IACAGAHSFA MMLAARACAG       120
     FFAGASRVIT VGIVRDRFRG DAMARVMSLI FAVFMLIPVM APTFGQAILW IAPWRWIFWA       180
     LAILATLILL WMGMRLPETL LPENRLRMSA GTIFRTVGTI VRTRTSIGYM LASGVVMSGL       240
     IGFILSVQQI FFDIFGAQGI FPFAFAAMAG SMGVGSLLNS RLVSRFGARR LSQTALLCLV       300
     SINVVHLAVI LAGHETIVSF MILQAATMMT IAFTASNFSA ISMEPFAKGA GVASSFQAFL       360
     TTAVSSALGS LIGQAFNGTT LPLTLGLAVF GSVSFLIVAW AERGNLFTRP HHGALRDPEF       420
     EPLH                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page