(data stored in ACNUC7421 zone)

EMBL: AP010803.BDH

AP010803.BDH         Location/Qualifiers
FT   CDS             complement(576850..577629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdh"
FT                   /locus_tag="SJA_C1-05660"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95400"
FT                   /db_xref="GOA:D4YYG8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG8"
FT                   /protein_id="BAI95400.1"
FT                   /translation="MMLSGKVAVITGAASGIGNDIALEFVRHGAKVVIADLQLEKAEAA
FT                   AAVLDPKGEAAMAVAMDVADERQVEAGVEAVIKRFGCVDILVSNAGIQIVAPLDEFKFS
FT                   DWKRLLAIHLDGAFLTTRACLKHMYAQGGGSVIYMGSVHSKEASVLKAPYVTAKHGLIG
FT                   LAKVVAKEGAAHGVRANVICPGFVRTPLVEKQIPEQARELGISEEDVIKKVMLKETVDG
FT                   EFTTVEDVARTAVFLAGFPSNALTGQSIVVSHGWFMQ"
     MMLSGKVAVI TGAASGIGND IALEFVRHGA KVVIADLQLE KAEAAAAVLD PKGEAAMAVA        60
     MDVADERQVE AGVEAVIKRF GCVDILVSNA GIQIVAPLDE FKFSDWKRLL AIHLDGAFLT       120
     TRACLKHMYA QGGGSVIYMG SVHSKEASVL KAPYVTAKHG LIGLAKVVAK EGAAHGVRAN       180
     VICPGFVRTP LVEKQIPEQA RELGISEEDV IKKVMLKETV DGEFTTVEDV ARTAVFLAGF       240
     PSNALTGQSI VVSHGWFMQ                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page