(data stored in SCRATCH zone)

EMBL: AP010803.BIOF

AP010803.BIOF        Location/Qualifiers
FT   CDS             complement(287298..288422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="SJA_C1-02730"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="7-keto-8-aminopelargonate synthetase or related
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95107"
FT                   /db_xref="GOA:D4YXM5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXM5"
FT                   /protein_id="BAI95107.1"
FT                   /translation="MTSEPFRSQLAALEKRGRLRRLMPRAGRDFASNDYLGLASDPIVA
FT                   QAVADAVARGVPVGSGGSRLLRGNAPEHEGLEAKAADFFKTQGALFMANGFAANLALFS
FT                   TLPQRGDLIVADELIHASVHDGIRMSKAAAVFARHNDVQSFADLIAAWRQEGGKGRVWI
FT                   AVETLYSMDGDMAPLGDLATLAARHDAMLILDEAHGTGVFGPSGRGLSAGLDGLHNVVT
FT                   LHTCGKAMGVEGALICGPRLLIDYLINRARAFIFSTAPSPLMAVAVSAALDRIEQASDL
FT                   RARLKTLQVDAAESICAPLGLPAPRSQIIPVILGEDRRAMAAAAALQEAGFDVRGIRPP
FT                   TVPPGTSRLRISLTLNVGRADIAALGEALRRVTA"
     MTSEPFRSQL AALEKRGRLR RLMPRAGRDF ASNDYLGLAS DPIVAQAVAD AVARGVPVGS        60
     GGSRLLRGNA PEHEGLEAKA ADFFKTQGAL FMANGFAANL ALFSTLPQRG DLIVADELIH       120
     ASVHDGIRMS KAAAVFARHN DVQSFADLIA AWRQEGGKGR VWIAVETLYS MDGDMAPLGD       180
     LATLAARHDA MLILDEAHGT GVFGPSGRGL SAGLDGLHNV VTLHTCGKAM GVEGALICGP       240
     RLLIDYLINR ARAFIFSTAP SPLMAVAVSA ALDRIEQASD LRARLKTLQV DAAESICAPL       300
     GLPAPRSQII PVILGEDRRA MAAAAALQEA GFDVRGIRPP TVPPGTSRLR ISLTLNVGRA       360
     DIAALGEALR RVTA                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page