(data stored in ACNUC7421 zone)

EMBL: AP010803.COAE

AP010803.COAE        Location/Qualifiers
FT   CDS             2411..3004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="SJA_C1-00040"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94838"
FT                   /db_xref="GOA:D4YWV6"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWV6"
FT                   /protein_id="BAI94838.1"
FT                   /translation="MKIYGLTGSIGMGKSAVAAMLRREGVPLFDADAEVHRLQGPGGAL
FT                   LPAIEARFPGTTGPRGVDRAKLGAAVFGHPQELKALEAIVHPAVQQGRRAFLQRNRSRR
FT                   FVVLDIPLLFERHGDRKLAGVIVVTAPAWKQRKRVLARPGMTAAKFRRIVHLQTPDAEK
FT                   RRRADYIIHTGTTFAETRFQVRRLVACLGAKTGR"
     MKIYGLTGSI GMGKSAVAAM LRREGVPLFD ADAEVHRLQG PGGALLPAIE ARFPGTTGPR        60
     GVDRAKLGAA VFGHPQELKA LEAIVHPAVQ QGRRAFLQRN RSRRFVVLDI PLLFERHGDR       120
     KLAGVIVVTA PAWKQRKRVL ARPGMTAAKF RRIVHLQTPD AEKRRRADYI IHTGTTFAET       180
     RFQVRRLVAC LGAKTGR                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page