(data stored in ACNUC7421 zone)

EMBL: AP010803.COBT

AP010803.COBT        Location/Qualifiers
FT   CDS             complement(105870..107696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="SJA_C1-01070"
FT                   /product="cobalamin biosynthesis protein"
FT                   /note="cobalamin biosynthesis protein CobT
FT                   (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole
FT                   phosphoribosyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94941"
FT                   /db_xref="GOA:D4YX59"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX59"
FT                   /protein_id="BAI94941.1"
FT                   /translation="MADRSPLDAFKDVLSGAARSIARDAEVEVGFTADTPHMAGKAIKV
FT                   PTPGRNLPADQVALARGYADANALRLRHHNAKVHNSAAPADATARAVYDAVEQARVEAI
FT                   GSRAMEGVRANLNHALDLKLKSDPIRRARSADEVPLSTALALKVRERLTGQAAPKDVRA
FT                   GLAMVDQWIEDKAGADLDALAMAIDDQRAFQKLTSAMLEHLQLIDADVPPETDDSEPQE
FT                   EGEEEEQSQEDGDSGEDQAGDSDALAEARAEDQGGDTEDGETEYSDEFDADSEEGAEDM
FT                   GEEGMMPVRPNRPMGDLPPGFDYKPYTQLHDEVVTAEDLCDEDELLRLRGFLDQQLVSL
FT                   QGAVTKLANRLQRRLMAQQSRSWDFDQEEGLLDAARLARIVIDPTRSLSYKIERDTEFR
FT                   DTVVTLLIDNSGSMRGRPISIAAISADIMARTLERCGVKTEILGFTTRAWKGGQSREDW
FT                   LAAGRPAMPGRLNDLRHIIYKKADEPWRRARKNLGLMMREGLLKENIDGEALLWAHGRL
FT                   IARNEERRILMVISDGAPVDDSTLSVNSGTYLERHLRQVIEWIENRSPVQLVAIGIGHD
FT                   VTRYYRRAVTIMDAEQLGGTMVEQLAGLFDED"
     MADRSPLDAF KDVLSGAARS IARDAEVEVG FTADTPHMAG KAIKVPTPGR NLPADQVALA        60
     RGYADANALR LRHHNAKVHN SAAPADATAR AVYDAVEQAR VEAIGSRAME GVRANLNHAL       120
     DLKLKSDPIR RARSADEVPL STALALKVRE RLTGQAAPKD VRAGLAMVDQ WIEDKAGADL       180
     DALAMAIDDQ RAFQKLTSAM LEHLQLIDAD VPPETDDSEP QEEGEEEEQS QEDGDSGEDQ       240
     AGDSDALAEA RAEDQGGDTE DGETEYSDEF DADSEEGAED MGEEGMMPVR PNRPMGDLPP       300
     GFDYKPYTQL HDEVVTAEDL CDEDELLRLR GFLDQQLVSL QGAVTKLANR LQRRLMAQQS       360
     RSWDFDQEEG LLDAARLARI VIDPTRSLSY KIERDTEFRD TVVTLLIDNS GSMRGRPISI       420
     AAISADIMAR TLERCGVKTE ILGFTTRAWK GGQSREDWLA AGRPAMPGRL NDLRHIIYKK       480
     ADEPWRRARK NLGLMMREGL LKENIDGEAL LWAHGRLIAR NEERRILMVI SDGAPVDDST       540
     LSVNSGTYLE RHLRQVIEWI ENRSPVQLVA IGIGHDVTRY YRRAVTIMDA EQLGGTMVEQ       600
     LAGLFDED                                                                608
//

If you have problems or comments...

PBIL Back to PBIL home page