(data stored in ACNUC7421 zone)

EMBL: AP010803.COMM

AP010803.COMM        Location/Qualifiers
FT   CDS             602916..604424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="SJA_C1-05930"
FT                   /product="magnesium chelatase family protein"
FT                   /note="putative ATPase with chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95427"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYJ5"
FT                   /protein_id="BAI95427.1"
FT                   /translation="MVSTVSTVAYLGLEARGVEVQCQLVPGLPNFIVVGLPDKAVAESR
FT                   ERVRNAIAAIGLSLPPKRITVNLSPADLPKEGSHFDLPIALALLGAMGVIDAETLAGYV
FT                   VVGELGLDGRIAPTPGVLLAALHAGERELGLVCPVAQGAEAAWAGQVEVIAAPDLLAIL
FT                   NHFKGAAALSPPRPGEVEPPVRTADLRQVKGQESAKRALEIAAAGGHNLLMVGPPGAGK
FT                   SLMASCLPGILPELTPGEALETSMVASVAGMLEGGRISRARPFRNPHHSASMAALVGGG
FT                   HKARPGEVSMAHLGVLFLDELPEFQRTVLDSLRQPLETGEVTVARANAHVTFPARVQLV
FT                   AAMNPCRCGHLGDPALACSRAPRCAADYQAKVSGPLLDRIDLHVEVQAVTAADLVLPPP
FT                   AEGSAEVAARVAAARAVQTRRYEGTSLRTNAEVDGERLEDVAGPDQAGRELLAQAAAAM
FT                   KLSARGYTRVLRVARTIADLAGAERVGRVHVAEALSYRRRAPVN"
     MVSTVSTVAY LGLEARGVEV QCQLVPGLPN FIVVGLPDKA VAESRERVRN AIAAIGLSLP        60
     PKRITVNLSP ADLPKEGSHF DLPIALALLG AMGVIDAETL AGYVVVGELG LDGRIAPTPG       120
     VLLAALHAGE RELGLVCPVA QGAEAAWAGQ VEVIAAPDLL AILNHFKGAA ALSPPRPGEV       180
     EPPVRTADLR QVKGQESAKR ALEIAAAGGH NLLMVGPPGA GKSLMASCLP GILPELTPGE       240
     ALETSMVASV AGMLEGGRIS RARPFRNPHH SASMAALVGG GHKARPGEVS MAHLGVLFLD       300
     ELPEFQRTVL DSLRQPLETG EVTVARANAH VTFPARVQLV AAMNPCRCGH LGDPALACSR       360
     APRCAADYQA KVSGPLLDRI DLHVEVQAVT AADLVLPPPA EGSAEVAARV AAARAVQTRR       420
     YEGTSLRTNA EVDGERLEDV AGPDQAGREL LAQAAAAMKL SARGYTRVLR VARTIADLAG       480
     AERVGRVHVA EALSYRRRAP VN                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page