(data stored in ACNUC7421 zone)

EMBL: AP010803.COPB

AP010803.COPB        Location/Qualifiers
FT   CDS             496507..497673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copB"
FT                   /locus_tag="SJA_C1-04910"
FT                   /product="copper resistance protein CopB"
FT                   /note="uncharacterized protein involved in copper
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95325"
FT                   /db_xref="GOA:D4YY93"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY93"
FT                   /protein_id="BAI95325.1"
FT                   /translation="MIRILTPLVSAIALFAAAPAFAQDHSMHGMPGMAPPGEVPPAQEK
FT                   KKDKATARPRAQTPAPDATSAMDHSQHQASPAPQGDAAGQPQPASPAMPDMPGMDHSQH
FT                   QDGAMPDMPGMDHSQHGQTATPGTSAMPGMQMTGTALPAGNAPPPPPPSDHFADHDFPG
FT                   AEMARSRDIMMKDSGGNNFGQMLLNLFEYQAHSGRDGYRWDGEGFYGGDINRLWLKSEG
FT                   EGEFGRGIDSAEVQVLYSRAIDPYFNLQGGIRQDFGRGPDRTYATVGVEGLAPGMFEVE
FT                   GALFLSTKGDVLGRVEGYYDQRITQRLILQPRAEVNFAAQDIPENDIGSGLVNIELGAR
FT                   LRYEFSRQFAPYIGVSYLRKAGDTARLSRLAGEDVHATSFVAGVRFWF"
     MIRILTPLVS AIALFAAAPA FAQDHSMHGM PGMAPPGEVP PAQEKKKDKA TARPRAQTPA        60
     PDATSAMDHS QHQASPAPQG DAAGQPQPAS PAMPDMPGMD HSQHQDGAMP DMPGMDHSQH       120
     GQTATPGTSA MPGMQMTGTA LPAGNAPPPP PPSDHFADHD FPGAEMARSR DIMMKDSGGN       180
     NFGQMLLNLF EYQAHSGRDG YRWDGEGFYG GDINRLWLKS EGEGEFGRGI DSAEVQVLYS       240
     RAIDPYFNLQ GGIRQDFGRG PDRTYATVGV EGLAPGMFEV EGALFLSTKG DVLGRVEGYY       300
     DQRITQRLIL QPRAEVNFAA QDIPENDIGS GLVNIELGAR LRYEFSRQFA PYIGVSYLRK       360
     AGDTARLSRL AGEDVHATSF VAGVRFWF                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page