(data stored in ACNUC7421 zone)

EMBL: AP010803.COPC

AP010803.COPC        Location/Qualifiers
FT   CDS             complement(492727..493107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copC"
FT                   /locus_tag="SJA_C1-04860"
FT                   /product="copper resistance protein CopC"
FT                   /note="uncharacterized protein, homolog of Cu resistance
FT                   protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95320"
FT                   /db_xref="GOA:D4YY88"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY88"
FT                   /protein_id="BAI95320.1"
FT                   /translation="MRFFSPLAAIAIVGLSVSAPAYAHPKLVSSAPAANASVSAPSRIT
FT                   LTFSEGLMPRLSGAEIVMTGMPGMPNHRMAVTGFKTSVEGDNKTLVLTLARPLSAGTYQ
FT                   VAWHVVSTDTHRIQGNLAFTVK"
     MRFFSPLAAI AIVGLSVSAP AYAHPKLVSS APAANASVSA PSRITLTFSE GLMPRLSGAE        60
     IVMTGMPGMP NHRMAVTGFK TSVEGDNKTL VLTLARPLSA GTYQVAWHVV STDTHRIQGN       120
     LAFTVK                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page