(data stored in ACNUC7421 zone)

EMBL: AP010803.COPD

AP010803.COPD        Location/Qualifiers
FT   CDS             complement(491790..492722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copD"
FT                   /locus_tag="SJA_C1-04850"
FT                   /product="copper resistance protein CopD"
FT                   /note="putative copper export protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95319"
FT                   /db_xref="GOA:D4YY87"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY87"
FT                   /protein_id="BAI95319.1"
FT                   /translation="MSEIGVIAIRWALYVDLGLLFGLPLFALYALGGGGRTVRSYLPLG
FT                   PMIVLLVLLGLLLSVLGFLVQASAMTGLPLTRPDLQLVSDLLNDTALGTALKVRLAALV
FT                   ILLPCAALYGRKPRVCVMTSTLAGAIALGTLAWSGHGAAGEGSAGWQQLASDLVHLLAA
FT                   GAWVGAIAAFLALVIPNVDTDGLARVLLTEQALRGFSMVGTVIVGLLVVTGTVNTLFLV
FT                   GSEHIAGLWQSSWGLLLTAKLVLFAGMLGLAALNRYRLTPSLSLAIEQEDAPRAMTLLR
FT                   GSLVVEGGLAIIILALVAWLGTLSPPMSM"
     MSEIGVIAIR WALYVDLGLL FGLPLFALYA LGGGGRTVRS YLPLGPMIVL LVLLGLLLSV        60
     LGFLVQASAM TGLPLTRPDL QLVSDLLNDT ALGTALKVRL AALVILLPCA ALYGRKPRVC       120
     VMTSTLAGAI ALGTLAWSGH GAAGEGSAGW QQLASDLVHL LAAGAWVGAI AAFLALVIPN       180
     VDTDGLARVL LTEQALRGFS MVGTVIVGLL VVTGTVNTLF LVGSEHIAGL WQSSWGLLLT       240
     AKLVLFAGML GLAALNRYRL TPSLSLAIEQ EDAPRAMTLL RGSLVVEGGL AIIILALVAW       300
     LGTLSPPMSM                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page