(data stored in ACNUC7421 zone)

EMBL: AP010803.COX11

AP010803.COX11       Location/Qualifiers
FT   CDS             676619..677194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cox11"
FT                   /gene_synonym="ctaG"
FT                   /locus_tag="SJA_C1-06730"
FT                   /product="cytochrome c oxidase subunit XI assembly protein"
FT                   /note="cytochrome oxidase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95507"
FT                   /db_xref="GOA:D4YYS5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYS5"
FT                   /protein_id="BAI95507.1"
FT                   /translation="MASLPPSPFDRDRRNRRTMIGMAGVGLAMLGLGFASVPLYRIFCE
FT                   RTGFGGTTQRADADVQVAEAAGHRMSIRFDSNVTPGMPWQFHPERHTQTVTVGARNMAI
FT                   FVAKNLSDRPVTGTATFNVTPSQAGAYFTKIQCFCFTQQTLQPGEQVRMPVIYYVDPKI
FT                   LTDADNKDTQEITLSYTFYPVEQDKKPS"
     MASLPPSPFD RDRRNRRTMI GMAGVGLAML GLGFASVPLY RIFCERTGFG GTTQRADADV        60
     QVAEAAGHRM SIRFDSNVTP GMPWQFHPER HTQTVTVGAR NMAIFVAKNL SDRPVTGTAT       120
     FNVTPSQAGA YFTKIQCFCF TQQTLQPGEQ VRMPVIYYVD PKILTDADNK DTQEITLSYT       180
     FYPVEQDKKP S                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page