(data stored in ACNUC7421 zone)

EMBL: AP010803.COXA

AP010803.COXA        Location/Qualifiers
FT   CDS             673786..675453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="SJA_C1-06700"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="heme/copper-type cytochrome/quinol oxidase, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95504"
FT                   /db_xref="GOA:D4YYS2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYS2"
FT                   /protein_id="BAI95504.1"
FT                   /translation="MTTITADHHGDHAHDHHDADHKPAFFQRWFMSTNHKDIGTLYLIF
FT                   AIVAGIIGGAISGLMRAELAQPGIQYLQTWAQFSDGPEATLDQAYHLWNVLITAHGLIM
FT                   VFFMVMPAMIGGFGNWFVPIMIGAPDMAFPRMNNISFWLLIPAFVLLLGSTFVPGGTGN
FT                   GAGTGWTVYAPLSTSGSAGPAVDMAILSLHVAGVSSILGAINFITTILNMRAPGMTLHK
FT                   MPLFVWSVLVTAFLLLLALPVLAAAITMLLTDRNFGTTFYDAAGGGDPELYQHLFWFFG
FT                   HPEVYIMILPGFGIISQIVSTFSRKPVFGYLGMAYAMVAIGVVGFVVWAHHMFTTGMSV
FT                   NVKMYFTAATMVIAVPTGIKIFSWIATIWGGSISYKTPMVWALGFIFLFTVGGVTGVVL
FT                   ANGGVDDVLHDTYYVVAHFHYVLSLGAVFGLFAGFYYWFPKMSGRMYNEFLGHLHFWVF
FT                   FVGVNMLFFPMHFLGLSGMPRRYPDYPEAFAYWNKFASHGYEIMAAGMLIFFVNLIWSL
FT                   AAGKKAEGNPWGEGATTLEWTLSSPPPFHQFETLPVID"
     MTTITADHHG DHAHDHHDAD HKPAFFQRWF MSTNHKDIGT LYLIFAIVAG IIGGAISGLM        60
     RAELAQPGIQ YLQTWAQFSD GPEATLDQAY HLWNVLITAH GLIMVFFMVM PAMIGGFGNW       120
     FVPIMIGAPD MAFPRMNNIS FWLLIPAFVL LLGSTFVPGG TGNGAGTGWT VYAPLSTSGS       180
     AGPAVDMAIL SLHVAGVSSI LGAINFITTI LNMRAPGMTL HKMPLFVWSV LVTAFLLLLA       240
     LPVLAAAITM LLTDRNFGTT FYDAAGGGDP ELYQHLFWFF GHPEVYIMIL PGFGIISQIV       300
     STFSRKPVFG YLGMAYAMVA IGVVGFVVWA HHMFTTGMSV NVKMYFTAAT MVIAVPTGIK       360
     IFSWIATIWG GSISYKTPMV WALGFIFLFT VGGVTGVVLA NGGVDDVLHD TYYVVAHFHY       420
     VLSLGAVFGL FAGFYYWFPK MSGRMYNEFL GHLHFWVFFV GVNMLFFPMH FLGLSGMPRR       480
     YPDYPEAFAY WNKFASHGYE IMAAGMLIFF VNLIWSLAAG KKAEGNPWGE GATTLEWTLS       540
     SPPPFHQFET LPVID                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page