(data stored in ACNUC7421 zone)

EMBL: AP010803.COXB

AP010803.COXB        Location/Qualifiers
FT   CDS             672754..673767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="SJA_C1-06690"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="heme/copper-type cytochrome/quinol oxidase, subunit
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95503"
FT                   /db_xref="GOA:D4YYS1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYS1"
FT                   /protein_id="BAI95503.1"
FT                   /translation="MNKVKSLVLAGLLAFAPTLAMNGPALAQDNAAVAAPAAGNEAVAA
FT                   DSAGNAAAPAAEAAPAAKVAAPPRMKPTPGIGMPMPGEITLQKQFSPTGHTARWLHDVM
FT                   LLPIITIISIFVLILMLYVMVRFRRSANPTPSKTSHNTVIEVIWTVVPVVILLAIAVPS
FT                   IGLLADQYKPAPKDALTVKVTGYQWYWGYEYPDNGIPEFVSNMLPKDKAEANGEPYLLA
FT                   PDNRLVLPVGRPIKLIITGADVIHSFAVPSLWVKMDAVPGRLNEKSFTIEKPGVYYGQC
FT                   SELCGARHGFMPIAIEALEPAQFDQWLLSQGGTLKGAAAATTAEAAAPAAAPAAKL"
     MNKVKSLVLA GLLAFAPTLA MNGPALAQDN AAVAAPAAGN EAVAADSAGN AAAPAAEAAP        60
     AAKVAAPPRM KPTPGIGMPM PGEITLQKQF SPTGHTARWL HDVMLLPIIT IISIFVLILM       120
     LYVMVRFRRS ANPTPSKTSH NTVIEVIWTV VPVVILLAIA VPSIGLLADQ YKPAPKDALT       180
     VKVTGYQWYW GYEYPDNGIP EFVSNMLPKD KAEANGEPYL LAPDNRLVLP VGRPIKLIIT       240
     GADVIHSFAV PSLWVKMDAV PGRLNEKSFT IEKPGVYYGQ CSELCGARHG FMPIAIEALE       300
     PAQFDQWLLS QGGTLKGAAA ATTAEAAAPA AAPAAKL                                337
//

If you have problems or comments...

PBIL Back to PBIL home page