(data stored in SCRATCH zone)

EMBL: AP010803.CUSA

AP010803.CUSA        Location/Qualifiers
FT   CDS             527243..530386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /gene_synonym="czcA"
FT                   /locus_tag="SJA_C1-05250"
FT                   /product="copper/silver efflux system membrane protein
FT                   CusA/CzcA"
FT                   /note="copper efflux system membrane protein CusA /
FT                   putative silver efflux pump, CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95359"
FT                   /db_xref="GOA:D4YYC7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC7"
FT                   /protein_id="BAI95359.1"
FT                   /translation="MIAHLIRWSVRNRFFVVLGMLALVGAGLWAVRSTPIDALPDLSDV
FT                   QVVIRTSYPGQAPQIVENQITYPLTTTMLSVPGAKTVRGYSFFGDSFVYVIFEDGTDLY
FT                   WARSRVLEYLNQVQGRLPASARSALGPDATGVGWVYEYALVDRTGRHDLSQLRGLQDWF
FT                   LRYELKTVTGVAEVASIGGMVKQYQVLLDPVKLAAYGVTHAQAVQAISQANQEAGGSVL
FT                   EMAEAEYMVRASGYLKTLDDFRAIPLKTAAGGVPVRLGDVATIQVGPEMRRGIAELNGE
FT                   GEVAGGVVILRSGKNARETIAAVKDKLADLRKSLPPGVEVVTVYDRSQLIDRAVENLTR
FT                   KLVEEFIVVALVCALFLWHVRSALVAILTLPLGVLAAFVVMRFQGVNANIMSLGGIAIA
FT                   IGAMVDAAVVMIENAHKRIERWEQDHPDRHLDGEMRWIVVTEAAAEVGPALFFSLLIIT
FT                   LSFIPVFTLEAQEGRLFAPLAFTKTYAMGAAAILSVTLVPILMGWLIRGRIPAEQANPV
FT                   NRWLTNIYRPAIDWTMKRPKAVLLIAALVFATTAWPLSRLGGEFMPNLDEGDLLYMPSA
FT                   LPGLSAAKASELLQQTDRLIKTVPEVESVFGKAGRAETATDPAPLEMFETTIQFKPRDQ
FT                   WRSGMTPERLVDELDRRVKLPGLANIWVPPIRNRIDMLATGIKSPIGVKVSGSDLAELD
FT                   RIAHDVETVARSVPGVSSALAERLTGGRYVDVDIDRAAAARFGLNIADVQAIVSGAIGG
FT                   ETIGETVEGLARYPISVRYPRELRDSLERLRALPILTPAGQQITLGTVANVSIAEGPPM
FT                   LKTENARPSTWVYVDVRGRDLASVVGDLQRAVAKQVRLSPGVSIAYSGQFEYLERAVDR
FT                   LKLVVPATLLIIFVLLYLIFGRFDEAALIMGTLPFALTGGIWTLYLLGFNQSIATGVGF
FT                   IALAGVSAEFGVVMLIYLKNALAERGAHPDAAEVEAAVREGALLRVRPKAMTVAVILAG
FT                   LLPILLGSGAGSEVMSRIAAPMIGGMLTAPLLSMFVLPAAYLLLRRPKTDPIPQPVSS"
     MIAHLIRWSV RNRFFVVLGM LALVGAGLWA VRSTPIDALP DLSDVQVVIR TSYPGQAPQI        60
     VENQITYPLT TTMLSVPGAK TVRGYSFFGD SFVYVIFEDG TDLYWARSRV LEYLNQVQGR       120
     LPASARSALG PDATGVGWVY EYALVDRTGR HDLSQLRGLQ DWFLRYELKT VTGVAEVASI       180
     GGMVKQYQVL LDPVKLAAYG VTHAQAVQAI SQANQEAGGS VLEMAEAEYM VRASGYLKTL       240
     DDFRAIPLKT AAGGVPVRLG DVATIQVGPE MRRGIAELNG EGEVAGGVVI LRSGKNARET       300
     IAAVKDKLAD LRKSLPPGVE VVTVYDRSQL IDRAVENLTR KLVEEFIVVA LVCALFLWHV       360
     RSALVAILTL PLGVLAAFVV MRFQGVNANI MSLGGIAIAI GAMVDAAVVM IENAHKRIER       420
     WEQDHPDRHL DGEMRWIVVT EAAAEVGPAL FFSLLIITLS FIPVFTLEAQ EGRLFAPLAF       480
     TKTYAMGAAA ILSVTLVPIL MGWLIRGRIP AEQANPVNRW LTNIYRPAID WTMKRPKAVL       540
     LIAALVFATT AWPLSRLGGE FMPNLDEGDL LYMPSALPGL SAAKASELLQ QTDRLIKTVP       600
     EVESVFGKAG RAETATDPAP LEMFETTIQF KPRDQWRSGM TPERLVDELD RRVKLPGLAN       660
     IWVPPIRNRI DMLATGIKSP IGVKVSGSDL AELDRIAHDV ETVARSVPGV SSALAERLTG       720
     GRYVDVDIDR AAAARFGLNI ADVQAIVSGA IGGETIGETV EGLARYPISV RYPRELRDSL       780
     ERLRALPILT PAGQQITLGT VANVSIAEGP PMLKTENARP STWVYVDVRG RDLASVVGDL       840
     QRAVAKQVRL SPGVSIAYSG QFEYLERAVD RLKLVVPATL LIIFVLLYLI FGRFDEAALI       900
     MGTLPFALTG GIWTLYLLGF NQSIATGVGF IALAGVSAEF GVVMLIYLKN ALAERGAHPD       960
     AAEVEAAVRE GALLRVRPKA MTVAVILAGL LPILLGSGAG SEVMSRIAAP MIGGMLTAPL      1020
     LSMFVLPAAY LLLRRPKTDP IPQPVSS                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page