(data stored in ACNUC7421 zone)

EMBL: AP010803.CUSB

AP010803.CUSB        Location/Qualifiers
FT   CDS             525756..527246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusB"
FT                   /locus_tag="SJA_C1-05240"
FT                   /product="copper efflux system membrane protein CusB"
FT                   /note="type I secrection membrane fusion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95358"
FT                   /db_xref="GOA:D4YYC6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC6"
FT                   /protein_id="BAI95358.1"
FT                   /translation="MTLDKSALRWGASILAVALLAGGTGYWAGHRQAPQSEATTPAGAG
FT                   KVLYWYDPMFPNQKFDKPGKSPFMDMQLVPRYADGGSAGAAPTVAVDPAARQSLGLRVV
FT                   AAKMGSLASALEVTGTIDFNQRDVAVIQARSGGFVSRVYARAPGDVVRAGAPIADLLLP
FT                   EWGGAQTEYLSVRRLGKPDLTAAARQRLRLMGMSDGLIASVERSGRPNGVVTITTPISG
FT                   TIQTLDARAGVTLAMGQTLAQVSGLGTVWLNAAVPEARAGDVRVGQNASTTLAGFPGER
FT                   FAGRVIAILPTTQADSRTLTVRIELPNRDGRLRPGMFASVALGGDAKPALLVPSEAVIR
FT                   TGRRTLVMLAAGDGRYHPAEVRIGREAGGETEILAGLSPGENVVVSGQFLIDSEASLSG
FT                   IEARPIGGGAASATIAAPASKATLYETTGKIERITANSVTLSHEPVPALDWPAMTMTFA
FT                   LANPGIARGFKAGDRVRFGFDRPPAGPTLRHMAKVAGQ"
     MTLDKSALRW GASILAVALL AGGTGYWAGH RQAPQSEATT PAGAGKVLYW YDPMFPNQKF        60
     DKPGKSPFMD MQLVPRYADG GSAGAAPTVA VDPAARQSLG LRVVAAKMGS LASALEVTGT       120
     IDFNQRDVAV IQARSGGFVS RVYARAPGDV VRAGAPIADL LLPEWGGAQT EYLSVRRLGK       180
     PDLTAAARQR LRLMGMSDGL IASVERSGRP NGVVTITTPI SGTIQTLDAR AGVTLAMGQT       240
     LAQVSGLGTV WLNAAVPEAR AGDVRVGQNA STTLAGFPGE RFAGRVIAIL PTTQADSRTL       300
     TVRIELPNRD GRLRPGMFAS VALGGDAKPA LLVPSEAVIR TGRRTLVMLA AGDGRYHPAE       360
     VRIGREAGGE TEILAGLSPG ENVVVSGQFL IDSEASLSGI EARPIGGGAA SATIAAPASK       420
     ATLYETTGKI ERITANSVTL SHEPVPALDW PAMTMTFALA NPGIARGFKA GDRVRFGFDR       480
     PPAGPTLRHM AKVAGQ                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page