(data stored in SCRATCH zone)

EMBL: AP010803.CUSF

AP010803.CUSF        Location/Qualifiers
FT   CDS             530383..530787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="SJA_C1-05260"
FT                   /product="copper efflux system periplasmic protein CusF"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95360"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC8"
FT                   /protein_id="BAI95360.1"
FT                   /translation="MKEKTMNHARLTIALGLAALTAACGKKAEAPVATETNEAAPAATM
FT                   SGDMGNMSMAPDANAAIKAKGHGTVTAIDKAAGTITLDHGPIPEAKWPAMTMAFKAAPS
FT                   ITDAVKVGDKVDFDLSLKGSDGEVTAIAKQ"
     MKEKTMNHAR LTIALGLAAL TAACGKKAEA PVATETNEAA PAATMSGDMG NMSMAPDANA        60
     AIKAKGHGTV TAIDKAAGTI TLDHGPIPEA KWPAMTMAFK AAPSITDAVK VGDKVDFDLS       120
     LKGSDGEVTA IAKQ                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page