(data stored in SCRATCH zone)

EMBL: AP010803.CYSQ

AP010803.CYSQ        Location/Qualifiers
FT   CDS             complement(83224..84021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="SJA_C1-00830"
FT                   /product="inositol monophosphatase family protein"
FT                   /EC_number="3.1.3.25"
FT                   /note="archaeal fructose-1,6-bisphosphatase or related
FT                   enzyme of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94917"
FT                   /db_xref="GOA:D4YX35"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX35"
FT                   /protein_id="BAI94917.1"
FT                   /translation="MPAADISLRDVVTAASDAADRALTLWAGGQTRVRQWEKVPGHPVC
FT                   EADLELDAMLRERLYAIDPSAGWLSEETADTVHRLDLPRVWVVDPIDGTRDYLRGRPGW
FT                   AVSVALVEHGEARFGILAAPARNELWIAQAGAGATRNGRTLRAGSRSILRGSRVPADQL
FT                   PRHDRDLVTVDKPNSIALRMAMVAADEADLVATVRWGNEWDVAAAALIAQEAGAIVTDA
FT                   LSNPFSFNRPQPTAFGLLCAAPGIHAAAAERLAPRARKILGRG"
     MPAADISLRD VVTAASDAAD RALTLWAGGQ TRVRQWEKVP GHPVCEADLE LDAMLRERLY        60
     AIDPSAGWLS EETADTVHRL DLPRVWVVDP IDGTRDYLRG RPGWAVSVAL VEHGEARFGI       120
     LAAPARNELW IAQAGAGATR NGRTLRAGSR SILRGSRVPA DQLPRHDRDL VTVDKPNSIA       180
     LRMAMVAADE ADLVATVRWG NEWDVAAAAL IAQEAGAIVT DALSNPFSFN RPQPTAFGLL       240
     CAAPGIHAAA AERLAPRARK ILGRG                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page